Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Kin28p |
Kin28p is involved in:
NER in Saccharomyces cerevisiae
Keywords:
FUNCTION: Catalytic component of the TFIIK complex (KIN28-CCL1 dimer) which is the protein kinase component of transcription factor IIH (TFIIH) and phosphorylates the C-terminal domain of RNA polymerase II during transition from transcription to elongation after preinitiation complex (PIC) formation, thereby positively regulating transcription. TFIIH (or factor B) is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has DNA- dependent ATPase activity and is essential for polymerase II transcription in vitro. Essential for cell proliferation.
CATALYTIC ACTIVITY: ATP + [DNA-directed RNA polymerase] = ADP + [DNA-directed RNA polymerase] phosphate.
SUBUNIT: CCL1 and KIN28 form the TFIIK complex, a component of the TFIIH holo complex. Component of a complex consisting of KIN28, CCL1 and TFB3. Interacts with TFB3. Also interacts with HNT1 and HOG1.
INTERACTION: P38800:-; NbExp=1; IntAct=EBI-9691, EBI-24597; P53124:PCL10; NbExp=1; IntAct=EBI-9691, EBI-23973;
SUBCELLULAR LOCATION: Nucleus.
PTM: Phosphorylation of Thr-162 regulates the affinity of interaction between CCL1, KIN28 and TFB3. Thr-162 phosphorylation does not vary through the cell cycle and is necessary for full kinase activity.
MISCELLANEOUS: Present with 4400 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
SIMILARITY: Contains 1 protein kinase domain.
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
6320095 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P06242 |
P06242 |
| PFAM: | - |
P06242 (Link - using uniprot id) |
| InterPro: | - |
P06242 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKVNMEYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMS AIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSIL FTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGL ARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELML RIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRD ELRKRFIAASEYALDFMCGMLTMNPQKRWTAVQCLESDYFKELPPPSDPS SIKIRN |
Kin28p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| KIN28, a yeast split gene coding for a putative protein kinase homologous to CDC28. | Simon M, Seraphin B, Faye G | EMBO J Oct. 1, 1986 |
| The kin28 protein kinase is associated with a cyclin in Saccharomyces cerevisiae. | Valay JG, Simon M, Faye G | J Mol Biol Nov. 20, 1993 |
| The sequence of a 20.3 kb DNA fragment from the left arm of Saccharomyces cerevisiae chromosome IV contains the KIN28, MSS2, PHO2, POL3 and DUN1 genes, and six new open reading frames. | Saiz JE, Buitrago MJ, Garcia R, Revuelta JL, Del Rey F | Yeast Sept. 1, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. | Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. | Nature May 1, 1997 |
| Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits. | Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD | J Biol Chem Aug. 1, 1997 |
| Cak1 is required for Kin28 phosphorylation and activation in vivo. | Espinoza FH, Farrell A, Nourse JL, Chamberlin HM, Gileadi O, Morgan DO | Mol Cell Biol Nov. 1, 1998 |
| Activating phosphorylation of the Kin28p subunit of yeast TFIIH by Cak1p. | Kimmelman J, Kaldis P, Hengartner CJ, Laff GM, Koh SS, Young RA, Solomon MJ | Mol Cell Biol July 1, 1999 |
| Kin28, the TFIIH-associated carboxy-terminal domain kinase, facilitates the recruitment of mRNA processing machinery to RNA polymerase II. | Rodriguez CR, Cho EJ, Keogh MC, Moore CL, Greenleaf AL, Buratowski S | Mol Cell Biol Feb. 1, 2000 |
| Interactions of Cdk7 and Kin28 with Hint/PKCI-1 and Hnt1 histidine triad proteins. | Korsisaari N, Makela TP | J Biol Chem Nov. 10, 2000 |
| Kin28 is found within TFIIH and a Kin28-Ccl1-Tfb3 trimer complex with differential sensitivities to T-loop phosphorylation. | Keogh MC, Cho EJ, Podolny V, Buratowski S | Mol Cell Biol March 1, 2002 |
| Osmostress-induced transcription by Hot1 depends on a Hog1-mediated recruitment of the RNA Pol II. | Alepuz PM, de Nadal E, Zapater M, Ammerer G, Posas F | EMBO J May 15, 2003 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Global analysis of protein localization in budding yeast. | Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK | Nature Oct. 16, 2003 |
| Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. | Gruhler A, Olsen JV, Mohammed S, Mortensen P, Faergeman NJ, Mann M, Jensen ON | Mol Cell Proteomics March 1, 2005 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|