|
|
Protein FULL name: Subunit of TFIIH and nucleotide excision repair factor 3 complexes, involved in transcription initiation, required for nucleotide excision repair; ring finger protein similar to mammalian CAK and TFIIH subunit
Tfb3p (Saccharomyces cerevisiae) is product of expression of
TFB3
gene.
FUNCTION: Acts as component of the general transcription and DNA
repair factor IIH (TFIIH or factor B), which is essential for both
basal and activated transcription, and is involved in nucleotide
excision repair (NER) of damaged DNA. TFIIH has CTD kinase and
DNA-dependent ATPase activity, and is essential for polymerase II
transcription in vitro.
SUBUNIT: Component of the transcription factor IIH (TFIIH) holo
but not the TFIIH core complex. Component of a complex consisting
of KIN28, CCL1 and TFB3; the KIN28-CCL1 dimer is known as the
TFIIK complex.
INTERACTION:
P37366:CCL1; NbExp=1; IntAct=EBI-31406, EBI-4385;
P06839:RAD3; NbExp=1; IntAct=EBI-31406, EBI-14762;
SUBCELLULAR LOCATION: Nucleus (By similarity).
MISCELLANEOUS: Present with 3050 molecules/cell in log phase SD
medium.
SIMILARITY: Contains 1 RING-type zinc finger.
SEQUENCE CAUTION:
Sequence=AAB40629.1; Type=Frameshift; Positions=262;
This protein can be a part of a given complexes:
Links to other databases:
Protein sequence:
MLMDEYEENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLG
PAQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFN
GDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIMNNLER
SRTEIESFEQRQKFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVNRLST
TTQDINETIEGVKNTVKLKKSSARRKLEELNRVLKNNPYFNSNVNVQNSR
LKDAVPFTPFNGDREAHPRFTLKGSVYNDPFIKDLEHRKEFIASGFNTNY
AYERVLTEAFMGLGCVISEEL
|
Tfb3p (Saccharomyces cerevisiae) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV.
|
Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al.
|
Nature
May 1, 1997
|
|
Genes for Tfb2, Tfb3, and Tfb4 subunits of yeast transcription/repair factor IIH. Homology to human cyclin-dependent kinase activating kinase and IIH subunits.
|
Feaver WJ, Henry NL, Wang Z, Wu X, Svejstrup JQ, Bushnell DA, Friedberg EC, Kornberg RD
|
J Biol Chem
Aug. 1, 1997
|
|
Rig2, a RING finger protein that interacts with the Kin28/Ccl1 CTD kinase in yeast.
|
Faye G, Simon M, Valay JG, Fesquet D, Facca C
|
Mol Gen Genet
Aug. 1, 1997
|
|
Kin28 is found within TFIIH and a Kin28-Ccl1-Tfb3 trimer complex with differential sensitivities to T-loop phosphorylation.
|
Keogh MC, Cho EJ, Podolny V, Buratowski S
|
Mol Cell Biol
March 1, 2002
|
|
Global analysis of protein expression in yeast.
|
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
|
Nature
Oct. 16, 2003
|
|
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH.
|
Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD
|
J Biol Chem
Nov. 7, 2003
|
|
Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway.
|
Gruhler A, Olsen JV, Mohammed S, Mortensen P, Faergeman NJ, Mann M, Jensen ON
|
Mol Cell Proteomics
March 1, 2005
|
|
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.
|
Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP
|
J Proteome Res
March 1, 2007
|
|
Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases.
|
Smolka MB, Albuquerque CP, Chen SH, Zhou H
|
Proc Natl Acad Sci U S A
June 19, 2007
|
|
A multidimensional chromatography technology for in-depth phosphoproteome analysis.
|
Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H
|
Mol Cell Proteomics
July 1, 2008
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|