Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Ntg1p |
Protein FULL name:
DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase involved in base excision repair; acts in both nucleus and mitochondrion; creates a double-strand break at mtDNA origins that stimulates replication in response to oxidative stress
Protein SHORT name:
NTG1, FUN33, SCR1
Ntg1p (Saccharomyces cerevisiae) is product of expression of NTG1 gene.
Ntg1p is involved in:
BER in Saccharomyces cerevisiae
Keywords:
FUNCTION: Excision repair N-glycosylase involved in the repair of DNA base damage in the mitochondria. NTG1 can use dihydrothymine, urea, and uracil glycol are substrates.
SUBCELLULAR LOCATION: Mitochondrion. Note=Mitochondrial transmembrane space or matrix.
SIMILARITY: Belongs to the nth/mutY family.
| NCBI GenPept GI number(s): |
6319304 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P31378 |
P31378 |
| PFAM: | - |
P31378 (Link - using uniprot id) |
| InterPro: | - |
P31378 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MQKISKYSSMAILRKRPLVKTETGPESELLPEKRTKIKQEEVVPQPVDID WVKSLPNKQYFEWIVVRNGNVPNRWATPLDPSILVTPASTKVPYKFQETY ARMRVLRSKILAPVDIIGGSSIPVTVASKCGISKEQISPRDYRLQVLLGV MLSSQTKDEVTAMAMLNIMRYCIDELHSEEGMTLEAVLQINETKLDELIH SVGFHTRKAKYILSTCKILQDQFSSDVPATINELLGLPGVGPKMAYLTLQ KAWGKIEGICVDVHVDRLTKLWKWVDAQKCKTPDQTRTQLQNWLPKGLWT EINGLLVGFGQIITKSRNLGDMLQFLPPDDPRSSLDWDLQSQLYKEIQQN IMSYPKWVKYLEGKRELNVEAEINVKHEEKTVEETMVKLENDISVKVED |
Ntg1p (Saccharomyces cerevisiae) is able to recognize following damages:
Ntg1p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Sequencing of chromosome I from Saccharomyces cerevisiae: analysis of a 32 kb region between the LTE1 and SPO7 genes. | Ouellette BF, Clark MW, Keng T, Storms RK, Zhong W, Zeng B, Fortin N, Delaney S, Barton A, Kaback DB, et al. | Genome Jan. 1, 1993 |
| Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: analysis of the genes in the FUN38-MAK16-SPO7 region. | Barton AB, Kaback DB | J Bacteriol April 1, 1994 |
| The nucleotide sequence of chromosome I from Saccharomyces cerevisiae. | Bussey H, Kaback DB, Zhong W, Vo DT, Clark MW, Fortin N, Hall J, Ouellette BF, Keng T, Barton AB, et al. | Proc Natl Acad Sci U S A April 25, 1995 |
| Saccharomyces cerevisiae Ntg1p and Ntg2p: broad specificity N-glycosylases for the repair of oxidative DNA damage in the nucleus and mitochondria. | You HJ, Swanson RL, Harrington C, Corbett AH, Jinks-Robertson S, Senturker S, Wallace SS, Boiteux S, Dizdaroglu M, Doetsch PW | Biochemistry Aug. 31, 1999 |
Last modification of this entry: Oct. 14, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|