Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Ntg2p |
Protein FULL name:
DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase involved in base excision repair, localizes to the nucleus; sumoylated
Protein SHORT name:
NTG2, SCR2
Ntg2p (Saccharomyces cerevisiae) is product of expression of NTG2 gene.
Ntg2p is involved in:
BER in Saccharomyces cerevisiae
Keywords:
FUNCTION: Excision repair N-glycosylase involved in the repair of DNA base damage in the nucleus. NTG2 can use dihydrothymine (poor substrate), urea, and uracil glycol are substrates.
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 125 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the nth/mutY family.
| NCBI GenPept GI number(s): |
6324530 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q08214 |
Q08214 |
| PFAM: | - |
Q08214 (Link - using uniprot id) |
| InterPro: | - |
Q08214 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MREESRSRKRKHIPVDIEEVEVRSKYFKKNERTVELVKENKINKDLQNYG GVNIDWIKALKPIEYFEWIESRTCDDPRTWGRPITKEEMINDSGAKVPES FLPIYNRVRLMRSKVKTPVDAMGCSMIPVLVSNKCGIPSEKVDPKNFRLQ FLIGTMLSAQTRDERMAQAALNITEYCLNTLKIAEGITLDGLLKIDEPVL ANLIRCVSFYTRKANFIKRTAQLLVDNFDSDIPYDIEGILSLPGVGPKMG YLTLQKGWGLIAGICVDVHVHRLCKMWNWVDPIKCKTAEHTRKELQVWLP HSLWYEINTVLVGFGQLICMARGKRCDLCLANDVCNARNEKLIESSKFHQ LEDKEDIEKVYSHWLDTVTNGITTERHKKK |
Ntg2p (Saccharomyces cerevisiae) is able to recognize following damages:
Ntg2p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. | Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. | Nature May 1, 1997 |
| Saccharomyces cerevisiae Ntg1p and Ntg2p: broad specificity N-glycosylases for the repair of oxidative DNA damage in the nucleus and mitochondria. | You HJ, Swanson RL, Harrington C, Corbett AH, Jinks-Robertson S, Senturker S, Wallace SS, Boiteux S, Dizdaroglu M, Doetsch PW | Biochemistry Aug. 31, 1999 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
Last modification of this entry: Oct. 14, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|