Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Pol30p |
Protein FULL name:
PCNA
Pol30p (Saccharomyces cerevisiae) is product of expression of POL30 gene.
Pol30p is involved in:
BER in Saccharomyces cerevisiae
- Gap filling and strand displacement with DPB3 in Saccharomyces cerevisiae
- Strand scission by APN1/APN2/Pol30/Rad27/Pol3/CDC9 complex in Saccharomyces cerevisiae
- Gap filling and strand displacement with Pol3 in Saccharomyces cerevisiae
- Strand scission by APN1/APN2/Pol30/Rad27/DPB3/CDC9 complex in Saccharomyces cerevisiae
- Removing overhang by complex with Pol3 in Saccharomyces cerevisiae
- Removing overhang by complex with DPB3 in Saccharomyces cerevisiae
- MutSalpha binds mismatch in heteroduplex DNA with nick 5' to mismatch in Saccharomyces cerevisiae
- MutSalpha interacts with MutLalpha on heteroduplex DNA with nick 5' to mismatch in Saccharomyces cerevisiae
- MutLalpha nicks heteroduplex DNA with nick 5' to mismatch in Saccharomyces cerevisiae
- ExoI loads onto heteroduplex DNA with nick 5' to mismatch (distant site) in Saccharomyces cerevisiae
- ExoI excises errorenous strand heteroduplex DNA with nick 5' to mismatch in Saccharomyces cerevisiae
- RPA protects single stranded DNA (5' directed) in Saccharomyces cerevisiae
- ExoI excises erroneous strand some distance beyond the mismatch (5' directed) in Saccharomyces cerevisiae
- DNA polymerase delta resynthesizes DNA (5' directed MMR) in Saccharomyces cerevisiae
- ExoI loads onto heteroduplex DNA with nick 5' to mismatch (on proximal site) in Saccharomyces cerevisiae
- ExoI excises errorenous strand heteroduplex DNA with nick 5' to mismatch (proximal site) in Saccharomyces cerevisiae
- RPA protects single stranded DNA (5' directed, proximal site) in Saccharomyces cerevisiae
- ExoI excises erroneous strand some distance beyond the mismatch (5' directed, proximal site) in Saccharomyces cerevisiae
- DNA polymerase 3 resynthesizes DNA (5' directed MMR, proximal site) in Saccharomyces cerevisiae
- MutSalpha binds mismatch in heteroduplex DNA with nick 3' to mismatch in Saccharomyces cerevisiae
- MutSalpha interacts with MutLalpha on heteroduplex DNA with nick 3' to mismatch in Saccharomyces cerevisiae
- MutLalpha nicks heteroduplex DNA with nick 3' to mismatch in Saccharomyces cerevisiae
- ExoI loads onto heteroduplex DNA with nick 3' to mismatch in Saccharomyces cerevisiae
- ExoI excises errorenous strand heteroduplex DNA with nick 3' to mismatch in Saccharomyces cerevisiae
- RPA protects single stranded DNA (3' directed) in Saccharomyces cerevisiae
- Polymerase 3 fills the gap in Saccharomyces cerevisiae
- DPB3 fills the gap in Saccharomyces cerevisiae
FUNCTION: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
SUBUNIT: Homotrimer. Interacts with RAD30 and MCM10.
INTERACTION: P32354:MCM10; NbExp=3; IntAct=EBI-12993, EBI-5965; P26793:RAD27; NbExp=1; IntAct=EBI-12993, EBI-14693; Q04049:RAD30; NbExp=2; IntAct=EBI-12993, EBI-36214;
SUBCELLULAR LOCATION: Nucleus.
PTM: Sumoylated on Lys-164, and to a lesser extent on Lys-127 by the UBC9/SIZ1 complex during S-phase; which impairs ubiquitination and function in DNA repair.
PTM: Monoubiquitinated on Lys-164 by the UBC2/RAD18 complex upon DNA damage, and then polyubiquitinated through 'Lys-63'-linkage by UBC13/MMS2. Ubiquitination is required for UBC2-mediated DNA repair.
SIMILARITY: Belongs to the PCNA family.
| NCBI GenPept GI number(s): |
6319564 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P15873 |
P15873 |
| PFAM: | - |
P15873 (Link - using uniprot id) |
| InterPro: | - |
P15873 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSL EIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSII LLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRD LSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMD QPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFL APKFNDEE |
Pol30p (Saccharomyces cerevisiae) is able to recognize following damages:
Pol30p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Molecular cloning, structure and expression of the yeast proliferating cell nuclear antigen gene. | Bauer GA, Burgers PM | Nucleic Acids Res Feb. 25, 1990 |
| Analysis of a 70 kb region on the right arm of yeast chromosome II. | Mannhaupt G, Stucka R, Ehnle S, Vetter I, Feldmann H | Yeast Oct. 1, 1994 |
| Crystal structure of the eukaryotic DNA polymerase processivity factor PCNA. | Krishna TS, Kong XP, Gary S, Burgers PM, Kuriyan J | Cell Dec. 1, 1994 |
| Complete DNA sequence of yeast chromosome II. | Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. | EMBO J Dec. 15, 1994 |
| Interaction with PCNA is essential for yeast DNA polymerase eta function. | Haracska L, Kondratick CM, Unk I, Prakash S, Prakash L | Mol Cell Aug. 1, 2001 |
| RAD6-dependent DNA repair is linked to modification of PCNA by ubiquitin and SUMO. | Hoege C, Pfander B, Moldovan GL, Pyrowolakis G, Jentsch S | Nature Sept. 12, 2002 |
| Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex. | Bowman GD, O'Donnell M, Kuriyan J | Nature June 17, 2004 |
| Global analyses of sumoylated proteins in Saccharomyces cerevisiae. Induction of protein sumoylation by cellular stresses. | Zhou W, Ryan JJ, Zhou H | J Biol Chem July 1, 2004 |
| A proteomic strategy for gaining insights into protein sumoylation in yeast. | Denison C, Rudner AD, Gerber SA, Bakalarski CE, Moazed D, Gygi SP | Mol Cell Proteomics March 1, 2005 |
| Interaction between PCNA and diubiquitinated Mcm10 is essential for cell growth in budding yeast. | Das-Bradoo S, Ricke RM, Bielinsky AK | Mol Cell Biol July 1, 2006 |
| Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. | Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J | Genome Res April 1, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|