Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Sem1p |
Protein FULL name:
Component of the lid subcomplex of the regulatory subunit of the 26S proteasome; involved in mRNA export mediated by the TREX-2 complex (Sac3p-Thp1p); ortholog of human DSS1
Sem1p (Saccharomyces cerevisiae) is product of expression of SEM1 gene.
FUNCTION: Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis.
SUBUNIT: Part of the 26S proteasome.
INTERACTION: P38348:HSM3; NbExp=1; IntAct=EBI-31337, EBI-21152; P22141:PRE1; NbExp=1; IntAct=EBI-31337, EBI-13988; P09938:RNR2; NbExp=1; IntAct=EBI-31337, EBI-15240; P33299:RPT1; NbExp=1; IntAct=EBI-31337, EBI-13910;
MISCELLANEOUS: Present with 5590 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the DSS1/SEM1 family.
| NCBI GenPept GI number(s): |
6320571 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | O94742 |
O94742 |
| PFAM: | - |
O94742 (Link - using uniprot id) |
| InterPro: | - |
O94742 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIK SNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ |
Sem1p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. | Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. | Nature May 1, 1997 |
| SEM1, a homologue of the split hand/split foot malformation candidate gene Dss1, regulates exocytosis and pseudohyphal differentiation in yeast. | Jantti J, Lahdenranta J, Olkkonen VM, Soderlund H, Keranen S | Proc Natl Acad Sci U S A Jan. 2, 1999 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Sem1p is a novel subunit of the 26 S proteasome from Saccharomyces cerevisiae. | Sone T, Saeki Y, Toh-e A, Yokosawa H | J Biol Chem July 2, 2004 |
| Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. | Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J | Genome Res April 1, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|