|
|
Protein FULL name: DNA polymerase mu,
Protein SHORT name: Pol Mu
POLM (Homo sapiens) is product of expression of
POLM
gene.
POLM is involved in:
NHEJ in Homo sapiens
TLS in Homo sapiens
Keywords:
FUNCTION: Seems to act as an Ig mutase which is responsible for
immunoglobulin (Ig) gene hypermutation.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) =
diphosphate + DNA(n+1).
COFACTOR: Magnesium (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
TISSUE SPECIFICITY: Expressed in a number of tissues. Abundant in
thymus.
SIMILARITY: Belongs to the DNA polymerase type-X family.
SIMILARITY: Contains 1 BRCT domain.
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
Links to other databases:
Protein sequence:
MLPKRRRARVGSPSGDAASSTPPSTRFPGVAIYLVEPRMGRSRRAFLTGL
ARSKGFRVLDACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALL
DISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLT
HHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQ
GLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKT
ADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRSDVDALQQ
VVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRV
MCRLQDQGLILYHQHQHSCCESPTRLAQQSHMDAFERSFCIFRLPQPPGA
AVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRK
EKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
|
POLM (Homo sapiens) is able to recognize following damages:
POLM (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
DNA polymerase mu (Pol mu), homologous to TdT, could act as a DNA mutator in eukaryotic cells.
|
Dominguez O, Ruiz JF, Lain de Lera T, Garcia-Diaz M, Gonzalez MA, Kirchhoff T, Martinez-A C, Bernad A, Blanco L
|
EMBO J
April 3, 2000
|
|
Two novel human and mouse DNA polymerases of the polX family.
|
Aoufouchi S, Flatter E, Dahan A, Faili A, Bertocci B, Storck S, Delbos F, Cocea L, Gupta N, Weill JC, Reynaud CA
|
Nucleic Acids Res
Sept. 15, 2000
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
|
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
|
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK
|
Sci Signal
Jan. 1, 2009
|
|
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
|
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S
|
Anal Chem
June 1, 2009
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|