Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Spo11p |
Protein FULL name:
Meiosis-specific protein that initiates meiotic recombination by catalyzing the formation of double-strand breaks in DNA via a transesterification reaction; required for homologous chromosome pairing and synaptonemal complex formation
Spo11p (Saccharomyces cerevisiae) is product of expression of SPO11 gene.
Keywords:
FUNCTION: Required for meiotic recombination. Mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination. The action of SPO11 is important in setting off a regulatory chain of events encompassing 5' to 3' resection. When there are no SPO11-DSBs, resection of a site specific VDE-DSB takes place but it is faster than in wild-type meiosis and increases the risk of uncovering flanking homology.
SUBCELLULAR LOCATION: Nucleus.
DEVELOPMENTAL STAGE: Meiosis-specific.
SIMILARITY: Belongs to the TOP6A family.
| NCBI GenPept GI number(s): |
6321765 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P23179 |
P23179 |
| PFAM: | - |
P23179 (Link - using uniprot id) |
| InterPro: | - |
P23179 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MALEGLRKKYKTRQELVKALTPKRRSIHLNSNGHSNGTPCSNADVLAHIK HFLSLAANSLEQHQQPISIVFQNKKKKGDTSSPDIHTTLDFPLNGPHLCT HQFKLKRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQW LDVIRFNFKLSPRKSLNIIPAQKGLVYSPFPIDIYDNILTCENEPKMQKQ TIFPGKPCLIPFFQDDAVIKLGTTSMCNIVIVEKEAVFTKLVNNYHKLST NTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFTDADPYGISIALNY THSNERNAYICTMANYKGIRITQVLAQNNEVHNKSIQLLSLNQRDYSLAK NLIASLTANSWDIATSPLKNVIIECQREIFFQKKAEMNEIDARIFEYK |
Spo11p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Isolation, DNA sequence, and regulation of a meiosis-specific eukaryotic recombination gene. | Atcheson CL, DiDomenico B, Frackman S, Esposito RE, Elder RT | Proc Natl Acad Sci U S A Nov. 1, 1987 |
| Large-scale analysis of gene expression, protein localization, and gene disruption in Saccharomyces cerevisiae. | Burns N, Grimwade B, Ross-Macdonald PB, Choi EY, Finberg K, Roeder GS, Snyder M | Genes Dev May 1, 1994 |
| Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII. | Johnston M, Andrews S, Brinkman R, Cooper J, Ding H, Dover J, Du Z, Favello A, Fulton L, Gattung S, et al. | Science Sept. 1, 1994 |
| An atypical topoisomerase II from Archaea with implications for meiotic recombination. | Bergerat A, de Massy B, Gadelle D, Varoutas PC, Nicolas A, Forterre P | Nature March 27, 1997 |
| Wild-type levels of Spo11-induced DSBs are required for normal single-strand resection during meiosis. | Neale MJ, Ramachandran M, Trelles-Sticken E, Scherthan H, Goldman AS | Mol Cell April 1, 2002 |
| Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. | Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J | Genome Res April 1, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|