REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Pso2p

Protein FULL name:

Nuclease required for a post-incision step in the repair of DNA single and double-strand breaks that result from interstrand crosslinks produced by a variety of mono- and bi-functional psoralen derivatives; induced by UV-irradiation

Pso2p (Saccharomyces cerevisiae) is product of expression of PSO2 gene.

Pso2p is involved in:

HRR in Saccharomyces cerevisiae

Keywords:

FUNCTION: Required for DNA interstrand cross-link repair. This requires cleavage of cross-linked DNA to generate DNA double strand breaks (DSBs). This protein has 5' exonuclease activity on single-stranded and double-stranded DNA, which appears to be necessary for the processing of DNA double strand breaks prior to ligation.

SUBCELLULAR LOCATION: Nucleus (Probable).

INDUCTION: Expression is increased by ultraviolet light and agents which induce DNA cross-links such as nitrogen mustard and psoralen.

MISCELLANEOUS: Present with 259 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family.

NCBI GenPept GI number(s):	6323786
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P30620	P30620
PFAM:	-	P30620 (Link - using uniprot id)
InterPro:	-	P30620 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MSRKSIVQIRRSEVKRKRSSTASSTSEGKTLHKNTHTSSKRQRTLTEFNI
PTSSNLPVRSSSYSFSRFSCSTSNKNTEPVIINDDDHNSICLEDTAKVEI
TIDTDEEELVSLHDNEVSAIENRTEDRIVTELEEQVNVKVSTEVIQCPIC
LENLSHLELYERETHCDTCIGSDPSNMGTPKKNIRSFISNPSSPAKTKRD
IATSKKPTRVKLVLPSFKIIKFNNGHEIVVDGFNYKASETISQYFLSHFH
SDHYIGLKKSWNNPDENPIKKTLYCSKITAILVNLKFKIPMDEIQILPMN
KRFWITDTISVVTLDANHCPGAIIMLFQEFLANSYDKPIRQILHTGDFRS
NAKMIETIQKWLAETANETIDQVYLDTTYMTMGYNFPSQHSVCETVADFT
LRLIKHGKNKTFGDSQRNLFHFQRKKTLTTHRYRVLFLVGTYTIGKEKLA
IKICEFLKTKLFVMPNSVKFSMMLTVLQNNENQNDMWDESLLTSNLHESS
VHLVPIRVLKSQETIEAYLKSLKELETDYVKDIEDVVGFIPTGWSHNFGL
KYQKKNDDDENEMSGNTEYCLELMKNDRDNDDENGFEISSILRQYKKYNK
FQVFNVPYSEHSSFNDLVKFGCKLKCSEVIPTVNLNNLWKVRYMTNWFQC
WENVRKTRAAK

Pso2p (Saccharomyces cerevisiae) belongs to following protein families:

fam50v00000023892

References:

Title	Authors	Journal
Molecular structure of the DNA cross-link repair gene SNM1 (PSO2) of the yeast Saccharomyces cerevisiae.	Richter D, Niegemann E, Brendel M	Mol Gen Genet Feb. 1, 1992
A single amino acid change in SNM1-encoded protein leads to thermoconditional deficiency for DNA cross-link repair in Saccharomyces cerevisiae.	Niegemann E, Brendel M	Mutat Res Nov. 1, 1994
Regulation of SNM1, an inducible Saccharomyces cerevisiae gene required for repair of DNA cross-links.	Wolter R, Siede W, Brendel M	Mol Gen Genet Jan. 5, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.	Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B	Nature May 1, 1997
Saccharomyces cerevisiae lacking Snm1, Rev3 or Rad51 have a normal S-phase but arrest permanently in G2 after cisplatin treatment.	Grossmann KF, Ward AM, Moses RE	Mutat Res Sept. 15, 2000
S. cerevisiae has three pathways for DNA interstrand crosslink repair.	Grossmann KF, Ward AM, Matkovic ME, Folias AE, Moses RE	Mutat Res Dec. 19, 2001
Metallo-beta-lactamase fold within nucleic acids processing enzymes: the beta-CASP family.	Callebaut I, Moshous D, Mornon JP, de Villartay JP	Nucleic Acids Res Aug. 15, 2002
The beta-lactamase motif in Snm1 is required for repair of DNA double-strand breaks caused by interstrand crosslinks in S. cerevisiae.	Li X, Moses RE	DNA Repair (Amst) Feb. 2, 2003
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003
Microhomology-dependent end joining and repair of transposon-induced DNA hairpins by host factors in Saccharomyces cerevisiae.	Yu J, Marshall K, Yamaguchi M, Haber JE, Weil CF	Mol Cell Biol Jan. 1, 2004
The yeast Snm1 protein is a DNA 5'-exonuclease.	Li X, Hejna J, Moses RE	DNA Repair (Amst) Jan. 3, 2005
DNA interstrand cross-link repair in the Saccharomyces cerevisiae cell cycle: overlapping roles for PSO2 (SNM1) with MutS factors and EXO1 during S phase.	Barber LJ, Ward TA, Hartley JA, McHugh PJ	Mol Cell Biol March 1, 2005
A multidimensional chromatography technology for in-depth phosphoproteome analysis.	Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H	Mol Cell Proteomics July 1, 2008

Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.