REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Ogg1p

Protein FULL name:

Mitochondrial glycosylase/lyase that specifically excises 7,8-dihydro-8-oxoguanine residues located opposite cytosine or thymine residues in DNA, repairs oxidative damage to mitochondrial DNA, contributes to UVA resistance

Ogg1p (Saccharomyces cerevisiae) is product of expression of OGG1 gene.

Ogg1p is involved in:

BER in Saccharomyces cerevisiae

Keywords:

FUNCTION: DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N- methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta- lyase activity that nicks DNA 3' to the lesion.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 3690 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the type-1 OGG1 family.

NCBI GenPept GI number(s):	6323580
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P53397	P53397
PFAM:	-	P53397 (Link - using uniprot id)
InterPro:	-	P53397 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MSYKFGKLAINKSELCLANVLQAGQSFRWIWDEKLNQYSTTMKIGQQEKY
SVVILRQDEENEILEFVAVGDCGNQDALKTHLMKYFRLDVSLKHLFDNVW
IPSDKAFAKLSPQGIRILAQEPWETLISFICSSNNNISRITRMCNSLCSN
FGNLITTIDGVAYHSFPTSEELTSRATEAKLRELGFGYRAKYIIETARKL
VNDKAEANITSDTTYLQSICKDAQYEDVREHLMSYNGVGPKVADCVCLMG
LHMDGIVPVDVHVSRIAKRDYQISANKNHLKELRTKYNALPISRKKINLE
LDHIRLMLFKKWGSYAGWAQGVLFSKEIGGTSGSTTTGTIKKRKWDMIKE
TEAIVTKQMKLKVELSDLHIKEAKID

Ogg1p (Saccharomyces cerevisiae) is able to recognize following damages:

8-oxoG
FapyA

Ogg1p (Saccharomyces cerevisiae) belongs to following protein families:

fam50v00000023873

References:

Title	Authors	Journal
Cloning and expression in Escherichia coli of the OGG1 gene of Saccharomyces cerevisiae, which codes for a DNA glycosylase that excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine.	van der Kemp PA, Thomas D, Barbey R, de Oliveira R, Boiteux S	Proc Natl Acad Sci U S A May 28, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.	Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B	Nature May 1, 1997
The Ogg1 protein of Saccharomyces cerevisiae: a 7,8-dihydro-8-oxoguanine DNA glycosylase/AP lyase whose lysine 241 is a critical residue for catalytic activity.	Girard PM, Guibourt N, Boiteux S	Nucleic Acids Res Aug. 15, 1997
Catalytic and DNA binding properties of the ogg1 protein of Saccharomyces cerevisiae: comparison between the wild type and the K241R and K241Q active-site mutant proteins.	Guibourt N, Castaing B, Van Der Kemp PA, Boiteux S	Biochemistry Jan. 22, 2000
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003

Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.