Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Tdp1p |
FUNCTION: DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. Hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. Cleaves also 5' phosphotyrosyl adducts resulting from dead-end complexes between DNA and the active site tyrosine of topoisomerase II. Contributes to DNA repair after radiation damage. Acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. May have low 3'exonuclease activity and may be able to remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. Has no exonuclease activity towards DNA or RNA with a 3'phosphate (By similarity).
INTERACTION: Q12306:SMT3; NbExp=1; IntAct=EBI-20997, EBI-17490; P23255:TAF2; NbExp=1; IntAct=EBI-20997, EBI-18862;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 2130 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the tyrosyl-DNA phosphodiesterase family.
| NCBI GenPept GI number(s): |
6319701 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P38319 |
P38319 |
| PFAM: | - |
P38319 (Link - using uniprot id) |
| InterPro: | - |
P38319 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSRETNFNGTKRKRSDVAEKVAQRWKSVRYSAEMENMAPVNSNNDSDDCV IVSESKIIDLTNQEQDLSERIETNDTAKGAVFKLMKSDFYEREDFMGEVE DMITLKDIFGTETLKRSILFSFQYELDFLLRQFHQNVENITIVGQKGTIM PIEARAMDATLAVILKKVKLIEITMPPFASHHTKLIINFYDNGECKIFLP SNNFTSMETNLPQQVCWCSPLLKIGKEGLPVPFKRSLIEYLNSYHLKDID ELITKSVEEVNFAPLSELEFVYSTPSKFQSSGLLSFYNKLEKLSAGTSAS DTAKHYLCQTSSIGTSLSRARDENLWTHLMIPLFTGIMSPPAKDTAGRKK AEILPTNSLINEYSQRKIKPYIIFPTEQEFVTSPLKWSSSGWFHFQYLQK KSYYEMLRNKFKVFYKQDPAMVTRRRGTTPAHSKFYMHCATNSAGPCDAS QVFKELEWCLYTSANLSQTAWGTVSRKPRNYEAGVLYHSRRLANTRKVTC RTFTRDRRGCAGNPTHVAVPFTLPVIPYDLAEDECFCLARHEND |
Tdp1p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Complete DNA sequence of yeast chromosome II. | Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. | EMBO J Dec. 15, 1994 |
| Yeast gene for a Tyr-DNA phosphodiesterase that repairs topoisomerase I complexes. | Pouliot JJ, Yao KC, Robertson CA, Nash HA | Science Oct. 15, 1999 |
| Genome-wide nuclear morphology screen identifies novel genes involved in nuclear architecture and gene-silencing in Saccharomyces cerevisiae. | Teixeira MT, Dujon B, Fabre E | J Mol Biol Aug. 23, 2002 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Tyrosyl-DNA phosphodiesterase (Tdp1) participates in the repair of Top2-mediated DNA damage. | Nitiss KC, Malik M, He X, White SW, Nitiss JL | Proc Natl Acad Sci U S A June 13, 2006 |
| Mutation of a conserved active site residue converts tyrosyl-DNA phosphodiesterase I into a DNA topoisomerase I-dependent poison. | He X, van Waardenburg RC, Babaoglu K, Price AC, Nitiss KC, Nitiss JL, Bjornsti MA, White SW | J Mol Biol Sept. 28, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|