Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
MAG |
Protein FULL name:
DNA-3-methyladenine glycosylase, 3-methyladenine DNA glycosidase.,
MAG (Arabidopsis thaliana) is product of expression of gene.
FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions (By similarity).
CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine, 3-methylguanine, 7-methylguanine and 7- methyladenine.
SUBCELLULAR LOCATION: Nucleus (Potential).
SIMILARITY: Belongs to the DNA glycosylase MPG family.
| NCBI GenPept GI number(s): |
2833373 |
| Species: | Arabidopsis thaliana |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q39147 |
Q39147 |
| PFAM: |
PF02245 |
PF02245 |
| InterPro: |
IPR011034 IPR003180 |
IPR011034 IPR003180 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKTPARRSKRVNQEESETNVTTRVVLRTRKTNCSKTRAARVRPDYPLTRT TSESEMKLMPPEFFQIDALDLAPRLLGKFMRRDNVVLRITEVEAYRPNDS ACHGRFGVTPRTAPVFGPGGHAYVYLCYGLHMMLNIVADKEGVGAAVLIR SCSPVSGMETIQERRGLKTDKPVLLNGPGKVGQALGLSTEWSHHPLYSPG GLELLDGGEDVEKVMVGPRVGIDYALPEHVNALWRFAVADTPWISAPKNT LKPL |
MAG (Arabidopsis thaliana) is able to recognize following damages:
MAG (Arabidopsis thaliana) belongs to following protein families:
References:
| Title | Authors | Journal |
| Cloning of a 3-methyladenine-DNA glycosylase from Arabidopsis thaliana. | Santerre A, Britt AB | Proc Natl Acad Sci U S A March 15, 1994 |
| Structural analysis of Arabidopsis thaliana chromosome 3. II. Sequence features of the 4,251,695 bp regions covered by 90 P1, TAC and BAC clones. | Kaneko T, Katoh T, Sato S, Nakamura A, Asamizu E, Tabata S | DNA Res June 1, 2000 |
| Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana. | Salanoubat M, Lemcke K, Rieger M, Ansorge W, Unseld M, Fartmann B, Valle G, Blocker H, Perez-Alonso M, Obermaier B, Delseny M, Boutry M, Grivell LA, Mache R, Puigdomenech P, De Simone V, Choisne N, Artiguenave F, Robert C, Brottier P, Wincker P, Cattolico L, Weissenbach J, Saurin W, Quetier F, Schafer M, Muller-Auer S, Gabel C, Fuchs M, Benes V, Wurmbach E, Drzonek H, Erfle H, Jordan N, Bangert S, Wiedelmann R, Kranz H, Voss H, Holland R, Brandt P, Nyakatura G, Vezzi A, D'Angelo M, Pallavicini A, Toppo S, Simionati B, Conrad A, Hornischer K, Kauer G, Lohnert TH, Nordsiek G, Reichelt J, Scharfe M, Schon O, Bargues M, Terol J, Climent J, Navarro P, Collado C, Perez-Perez A, Ottenwalder B, Duchemin D, Cooke R, Laudie M, Berger-Llauro C, Purnelle B, Masuy D, de Haan M, Maarse AC, Alcaraz JP, Cottet A, Casacuberta E, Monfort A, Argiriou A, flores M, Liguori R, Vitale D, Mannhaupt G, Haase D, Schoof H, Rudd S, Zaccaria P, Mewes HW, Mayer KF, Kaul S, Town CD, Koo HL, Tallon LJ, Jenkins J, Rooney T, Rizzo M, Walts A, Utterback T, Fujii CY, Shea TP, Creasy TH, Haas B, Maiti R, Wu D, Peterson J, Van Aken S, Pai G, Militscher J, Sellers P, Gill JE, Feldblyum TV, Preuss D, Lin X, Nierman WC, Salzberg SL, White O, Venter JC, Fraser CM, Kaneko T, Nakamura Y, Sato S, Kato T, Asamizu E, Sasamoto S, Kimura T, Idesawa K, Kawashima K, Kishida Y, Kiyokawa C, Kohara M, Matsumoto M, Matsuno A, Muraki A, Nakayama S, Nakazaki N, Shinpo S, Takeuchi C, Wada T, Watanabe A, Yamada M, Yasuda M, Tabata S | Nature Dec. 14, 2000 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|