REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Rad18p

Protein FULL name:

E3 ubiqutin ligase, forms heterodimer with Rad6p to monoubiquitinate PCNA-K164; heterodimer binds single-stranded DNA and has single-stranded DNA dependent ATPase activity; required for postreplication repair

Rad18p (Saccharomyces cerevisiae) is product of expression of RAD18 gene.

FUNCTION: E3 RING-finger protein, member of the UBC2/RAD6 epistasis group. Associates to the E2 ubiquitin conjugating enzyme UBC2/RAD6 to form the UBC2-RAD18 ubiquitin ligase complex involved in postreplicative repair (PRR) of damaged DNA. The UBC2-RAD18 complex cooperates with RAD5 and the UBC13-MMS2 dimer to attach mono-ubiquitin chains on 'Lys-164' of POL30, which is necessary for PRR. The UBC2-RAD18 complex is also involved in prevention of spontaneous mutations caused by 7,8-dihydro-8-oxoguanine.

PATHWAY: Protein modification; protein ubiquitination.

SUBUNIT: Homodimer. Interacts with E2 UBC2, forming a complex with ubiquitin ligase activity. The UBC2-RAD18 complex interacts itself with the UBC13-MMS2 ubiquitin ligase complex through direct interactions of both RAD18 and UBC13 with RAD5. Interacts also with UBC9. Binds single strand DNA.

INTERACTION: P06104:RAD6; NbExp=2; IntAct=EBI-14659, EBI-19722;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 206 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the RAD18 family.

SIMILARITY: Contains 1 Rad18-type zinc finger.

SIMILARITY: Contains 1 RING-type zinc finger.

SIMILARITY: Contains 1 SAP domain.

NCBI GenPept GI number(s):	6319911
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P10862	P10862
PFAM:	-	P10862 (Link - using uniprot id)
InterPro:	-	P10862 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MDHQITTASDFTTTSIPSLYQLDTLLRCHICKDFLKVPVLTPCGHTFCSL
CIRTHLNNQPNCPLCLFEFRESLLRSEFLVSEIIQSYTSLRSSLLDALRI
PKPTPVPENEEVPGPENSSWIELISESESDSVNAADDDLQIVATSERKLA
KRSMTDILPLSSKPSKRNFAMFRSERIKKKSKPNEQMAQCPICQQFYPLK
ALEKTHLDECLTLQSLGKKPKISTTFPTESNPHNKSSSRFKVRTPEVDKS
SCGETSHVDKYLNSMMSAEHQRLPKINFTSMTQSQIKQKLSSLGLSTNGT
RQNMIKRYNHYEMLWNSNFCDSLEPVDEAELKRQLLSWDVSHNKTPQNSS
NKGGISKLMIMKSNGKSSSYRKLLENFKNDKFNRKGWMVMFRKDFARLIR
EAKMKIKTGSSDSSGSVGHSNDGDGVEKVQSDQGTEDQQMEKDQDTVINE
DRVAGERNLPNEDSTDADLSRELMDLNEYSKDPPGNN

Rad18p (Saccharomyces cerevisiae) belongs to following protein families:

fam50v00000027375

References:

Title	Authors	Journal
The Saccharomyces cerevisiae RAD18 gene encodes a protein that contains potential zinc finger domains for nucleic acid binding and a putative nucleotide binding sequence.	Jones JS, Weber S, Prakash L	Nucleic Acids Res July 25, 1988
Potential DNA-binding domains in the RAD18 gene product of Saccharomyces cerevisiae.	Chanet R, Magana-Schwencke N, Fabre F	Gene Dec. 1, 1988
Sequence of the sup61-RAD18 region on chromosome III of Saccharomyces cerevisiae.	Benit P, Chanet R, Fabre F, Faye G, Fukuhara H, Sor F	Yeast Jan. 1, 1992
The complete DNA sequence of yeast chromosome III.	Oliver SG, van der Aart QJ, Agostoni-Carbone ML, Aigle M, Alberghina L, Alexandraki D, Antoine G, Anwar R, Ballesta JP, Benit P, et al.	Nature May 7, 1992
Specific complex formation between yeast RAD6 and RAD18 proteins: a potential mechanism for targeting RAD6 ubiquitin-conjugating activity to DNA damage sites.	Bailly V, Lamb J, Sung P, Prakash S, Prakash L	Genes Dev April 1, 1994
Yeast DNA repair proteins Rad6 and Rad18 form a heterodimer that has ubiquitin conjugating, DNA binding, and ATP hydrolytic activities.	Bailly V, Lauder S, Prakash S, Prakash L	J Biol Chem Sept. 12, 1997
Two RING finger proteins mediate cooperation between ubiquitin-conjugating enzymes in DNA repair.	Ulrich HD, Jentsch S	EMBO J July 3, 2000
The Saccharomyces cerevisiae RAD6 group is composed of an error-prone and two error-free postreplication repair pathways.	Xiao W, Chow BL, Broomfield S, Hanna M	Genetics Aug. 1, 2000
RAD6-dependent DNA repair is linked to modification of PCNA by ubiquitin and SUMO.	Hoege C, Pfander B, Moldovan GL, Pyrowolakis G, Jentsch S	Nature Sept. 12, 2002
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003
The post-replication repair RAD18 and RAD6 genes are involved in the prevention of spontaneous mutations caused by 7,8-dihydro-8-oxoguanine in Saccharomyces cerevisiae.	de Padula M, Slezak G, Auffret van Der Kemp P, Boiteux S	Nucleic Acids Res Jan. 1, 2004
Rad18/Rad5/Mms2-mediated polyubiquitination of PCNA is implicated in replication completion during replication stress.	Branzei D, Seki M, Enomoto T	Genes Cells Nov. 1, 2004
The error-free component of the RAD6/RAD18 DNA damage tolerance pathway of budding yeast employs sister-strand recombination.	Zhang H, Lawrence CW	Proc Natl Acad Sci U S A Nov. 1, 2005
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.	Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF	Proc Natl Acad Sci U S A Jan. 13, 2007
A multidimensional chromatography technology for in-depth phosphoproteome analysis.	Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H	Mol Cell Proteomics July 1, 2008

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.