Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Ung1p |
Ung1p is involved in:
BER in Saccharomyces cerevisiae
Keywords:
FUNCTION: Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.
CATALYTIC ACTIVITY: Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.
SUBCELLULAR LOCATION: Nucleus. Mitochondrion.
MISCELLANEOUS: Present with 4820 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the uracil-DNA glycosylase family.
| NCBI GenPept GI number(s): |
6323620 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P12887 |
P12887 |
| PFAM: | - |
P12887 (Link - using uniprot id) |
| InterPro: | - |
P12887 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MWCMRRLPTNSVMTVARKRKQTTIEDFFGTKKSTNEAPNKKGKSGATFMT ITNGAAIKTETKAVAKEANTDKYPANSNAKDVYSKNLSSNLRTLLSLELE TIDDSWFPHLMDEFKKPYFVKLKQFVTKEQADHTVFPPAKDIYSWTRLTP FNKVKVVIIGQDPYHNFNQAHGLAFSVKPPTPAPPSLKNIYKELKQEYPD FVEDNKVGDLTHWASQGVLLLNTSLTVRAHNANSHSKHGWETFTKRVVQL LIQDREADGKSLVFLLWGNNAIKLVESLLGSTSVGSGSKYPNIMVMKSVH PSPLSASRGFFGTNHFKMINDWLYNTRGEKMIDWSVVPGTSLREVQEANA RLESESKDP |
Ung1p (Saccharomyces cerevisiae) is able to recognize following damages:
Ung1p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Molecular cloning and primary structure of the uracil-DNA-glycosylase gene from Saccharomyces cerevisiae. | Percival KJ, Klein MB, Burgers PM | J Biol Chem Jan. 15, 1989 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. | Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B | Nature May 1, 1997 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|