Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RecQ

Protein FULL name:

recQ [Escherichia coli].


RecQ (Escherichia coli strain K-12 substr. MG1655) is product of expression of recQ gene.


RecQ is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     





FUNCTION: Involved in the recF recombination pathway; its gene expression is under the regulation of the SOS system. It is a DNA helicase.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

SIMILARITY: Belongs to the helicase family. RecQ subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.

SIMILARITY: Contains 1 HRDC domain.

SEQUENCE CAUTION: Sequence=AAA24517.1; Type=Erroneous initiation; Sequence=AAA67618.1; Type=Erroneous initiation;


NCBI GenPept GI number(s): 147559
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P15043 P15043
PFAM: - P15043 (Link - using uniprot id)
InterPro: - P15043 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MNVAQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMP
TGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNST
QTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEA
HCISQWGHDFRPEYAALGQLRQRFPTLPFMALTATADDTTRQDIVRLLGL
NDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAK
VEDTAAALQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGM
GINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWL
RRCLEEKPQGQLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCG
NCDICLDPPKQYDGSTDAQIALSTIGRVNQRFGMGYVVEVIRGANNQRIR
DYGHDKLKVYGMGRDKSHEHWVSVIRQLIHLGLVTQNIAQHSALQLTEAA
RPVLAESSLQLAVPRIVALKPKAMQKSFGGNYDRKLFAKLRKLRKSIADE
SNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALI
PAHVDGDDEE

References:

Title Authors Journal
The recQ gene of Escherichia coli K12: primary structure and evidence for SOS regulation. Irino N, Nakayama K, Nakayama H Mol Gen Genet Nov. 1, 1986
Escherichia coli RecQ protein is a DNA helicase. Umezu K, Nakayama K, Nakayama H Proc Natl Acad Sci U S A July 1, 1990
Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes. Daniels DL, Plunkett G 3rd, Burland V, Blattner FR Science Aug. 7, 1992
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006
Escherichia coli K-12: a cooperatively developed annotation snapshot--2005. Riley M, Abe T, Arnaud MB, Berlyn MK, Blattner FR, Chaudhuri RR, Glasner JD, Horiuchi T, Keseler IM, Kosuge T, Mori H, Perna NT, Plunkett G 3rd, Rudd KE, Serres MH, Thomas GH, Thomson NR, Wishart D, Wanner BL Nucleic Acids Res Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.