Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

MutS

Protein FULL name:

MutS [Escherichia coli].


MutS (Escherichia coli strain K-12 substr. MG1655) is product of expression of mutS gene.






FUNCTION: This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase activity.

INTERACTION: P0A6N1:tufA; NbExp=1; IntAct=EBI-554920, EBI-301077;

SIMILARITY: Belongs to the DNA mismatch repair mutS family.


NCBI GenPept GI number(s): 17017340
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P23909 P23909
PFAM: - P23909 (Link - using uniprot id)
InterPro: - P23909 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
SAIENFDAHTPMMQQYLRLKAQHPEILLFYRMGDFYELFYDDAKRASQLL
DISLTKRGASAGEPIPMAGIPYHAVENYLAKLVNQGESVAICEQIGDPAT
SKGPVERKVVRIVTPGTISDEALLQERQDNLLAAIWQDSKGFGYATLDIS
SGRFRLSEPADRETMAAELQRTNPAELLYAEDFAEMSLIEGRRGLRRRPL
WEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCLLQYAKDTQRTT
LPHIRSITMEREQDSIIMDAATRRNLEITQNLAGGAENTLASVLDCTVTP
MGSRMLKRWLHMPVRDTRVLLERQQTIGALQDFTAGLQPVLRQVGDLERI
LARLALRTARPRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFA
ELRDLLERAIIDTPPVLVRDGGVIASGYNEELDEWRALADGATDYLERLE
VRERERTGLDTLKVGFNAVHGYYIQISRGQSHLAPINYMRRQTLKNAERY
IIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLEALQQSASALAE
LDVLVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANPL
NLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPID
RIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTST
YDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEGVANVHLDALE
HGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELESISP
NAAATQVDGTQMSLLSVPE

MutS (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:

Title Authors Journal
The Escherichia coli fdv gene probably encodes mutS and is located at minute 58.8 adjacent to the hyc-hyp gene cluster. Schlensog V, Bock A J Bacteriol Dec. 1, 1991
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.