Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Mfd

Protein FULL name:

transcription-repair coupling factor [Escherichia coli str. K-12 substr. MG1655].


Mfd (Escherichia coli strain K-12 substr. MG1655) is product of expression of mfd gene.


Mfd is involved in:

NER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Necessary for strand-specific repair. A lesion in the template strand blocks the RNA polymerase complex (RNAP). The RNAP-DNA-RNA complex is specifically recognized by TRCF which releases RNAP and the truncated transcript; the TCRF may replace RNAP at the lesion site and then recruit the uvrA/B/C repair system.

INTERACTION: P0A8V2:rpoB; NbExp=2; IntAct=EBI-554211, EBI-544996;

SIMILARITY: In the N-terminal section; belongs to the uvrB family.

SIMILARITY: In the C-terminal section; belongs to the helicase family. RecG subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.


NCBI GenPept GI number(s): 1787357
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P30958 P30958
PFAM: - P30958 (Link - using uniprot id)
InterPro: - P30958 (Link - using uniprot id)
CATH: None  
SCOP: None  
PDB: - -


Protein sequence:
MPEQYRYTLPVKAGEQRLLGELTGAACATLVAEIAERHAGPVVLIAPDMQ
NALRLHDEISQFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLPT
MQRGVLIVPVNTLMQRVCPHSFLHGHALVMKKGQRLSRDALRTQLDSAGY
RHVDQVMEHGEYATRGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQ
RTLEEVEAINLLPAHEFPTDKAAIELFRSQWRDTFEVKRDPEHIYQQVSK
GTLPAGIEYWQPLFFSEPLPPLFSYFPANTLLVNTGDLETSAERFQADTL
ARFENRGVDPMRPLLPPQSLWLRVDELFSELKNWPRVQLKTEHLPTKAAN
ANLGFQKLPDLAVQAQQKAPLDALRKFLETFDGPVVFSVESEGRREALGE
LLARIKIAPQRIMRLDEASDRGRYLMIGAAEHGFVDTVRNLALICESDLL
GERVARRRQDSRRTINPDTLIRNLAELHIGQPVVHLEHGVGRYAGMTTLE
AGGITGEYLMLTYANDAKLYVPVSSLHLISRYAGGAEENAPLHKLGGDAW
SRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFKHDREQYQLFCDSFPFE
TTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHK
QVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVA
EGKIDILIGTHKLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVD
ILTLTATPIPRTLNMAMSGMRDLSIIATPPARRLAVKTFVREYDSMVVRE
AILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAIGHGQMREREL
ERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLR
GRVGRSHHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFALATHDL
EIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKAGREPSLEDLTSQ
QTEVELRMPSLLPDDFIPDVNTRLSFYKRIASAKTENELEEIKVELIDRF
GLLPDPARTLLDIARLRQQAQKLGIRKLEGNEKGGVIEFAEKNHVNPAWL
IGLLQKQPQHYRLDGPTRLKFIQDLSERKTRIEWVRQFMRELEENAIA

References:

Title Authors Journal
Molecular mechanism of transcription-repair coupling. Selby CP, Sancar A Science April 2, 1993
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.