Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

DnaX

Protein FULL name:

DNA polymerase III subunit tau; Contains: DNA polymerase III subunit gamma.


DnaX (Escherichia coli strain K-12 substr. MG1655) is product of expression of dnaX gene.


DnaX is involved in:

MMR in Escherichia coli strain K-12 substr. MG1655
     


Keywords:



FUNCTION: DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity.

FUNCTION: The tau chain serves as a scaffold to help in the dimerizaton of the core complex.

FUNCTION: The gamma chain seems to interact with the delta subunit to transfer the beta subunit on the DNA.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SUBUNIT: The DNA polymerase holoenzyme is a complex that contains 10 different types of subunits. These subunits are organized into 3 functionally essential subassemblies: the pol III core, the beta sliding clamp processivity factor and the clamp-loading complex. The pol III core (subunits alpha,epsilon and theta) contains the polymerase and the 3'-5' exonuclease proofreading activities. The polymerase is tethered to the template via the sliding clamp processivity factor. The clamp-loading complex assembles the beta processivity factor onto the primer template and plays a central role in the organization and communication at the replication fork. This complex contains delta, delta', psi and chi, and copies of either or both of two different dnaX proteins, gamma and tau. The composition of the holoenzyme is, therefore: (alpha,epsilon,theta)[2]-(gamma/tau)[3]-delta,delta', psi,chi- beta[4].

INTERACTION: P0A988:dnaN; NbExp=1; IntAct=EBI-549140, EBI-542385; P0A7L0:rplA; NbExp=1; IntAct=EBI-549140, EBI-543771;

MISCELLANEOUS: The production of the two protein products from this region is due to programmed ribosomal frameshifting.

SEQUENCE CAUTION: Sequence=CAA28175.1; Type=Erroneous initiation;


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 118808
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P06710 P06710
PFAM: PF00004
PF12168
PF12170
PF00004
PF12168
PF12170
InterPro: IPR003593
IPR003959
IPR001270
IPR008921
IPR022001
IPR012763
IPR021029
IPR003593
IPR003959
IPR001270
IPR008921
IPR022001
IPR012763
IPR021029
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVG
KTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTK
VEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHV
KFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEP
RALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQAL
SLVEAMVEANGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPA
ALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVE
MTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQA
PTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERL
ASVTDRVQARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKA
LEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVALNAWKEESDN
AVCLHLRSSQRHLNNRGAQQKLAEALSMLKGSTVELTIVEDDNPAVRTPL
EWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESIRPI

References:

Title Authors Journal
Nucleotide sequence of the Escherichia coli replication gene dnaZX. Yin KC, Blinkowa A, Walker JR Nucleic Acids Res Aug. 26, 1986
The adjacent dnaZ and dnaX genes of Escherichia coli are contained within one continuous open reading frame. Flower AM, McHenry CS Nucleic Acids Res Oct. 24, 1986
Translational frameshifting generates the gamma subunit of DNA polymerase III holoenzyme. Tsuchihashi Z, Kornberg A Proc Natl Acad Sci U S A April 1, 1990
Programmed ribosomal frameshifting generates the Escherichia coli DNA polymerase III gamma subunit from within the tau subunit reading frame. Blinkowa AL, Walker JR Nucleic Acids Res April 11, 1990
The gamma subunit of DNA polymerase III holoenzyme of Escherichia coli is produced by ribosomal frameshifting. Flower AM, McHenry CS Proc Natl Acad Sci U S A May 1, 1990
Accessory protein function in the DNA polymerase III holoenzyme from E. coli. O'Donnell M Bioessays Jan. 1, 1992
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.