Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

MutY

Protein FULL name:

adenine DNA glycosylase [Escherichia coli str. K-12 substr. MG1655].


MutY (Escherichia coli strain K-12 substr. MG1655) is product of expression of mutY gene.


MutY is involved in:

BER in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Adenine glycosylase active on G-A mispairs. MutY also corrects error-prone DNA synthesis past GO lesions which are due to the oxidatively damaged form of guanine: 7,8-dihydro-8- oxoguanine (8-oxo-dGTP).

COFACTOR: Binds 1 4Fe-4S cluster. The cluster is not important for the catalytic activity, but which is probably involved in the proper positioning of the enzyme along the DNA strand.

SIMILARITY: Belongs to the nth/mutY family.


NCBI GenPept GI number(s): 16130862
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P17802 P17802
PFAM: - P17802 (Link - using uniprot id)
InterPro: - P17802 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIP
YFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLH
GGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYA
VSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCS
LCPLQNGCIAAANNSWALYPGKKPKQTLPERTGYFLLLQHEDEVLLAQRP
PSGLWGGLYCFPQFADEESLRQWLAQRQIAADNLTQLTAFRHTFSHFHLD
IVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAPV

MutY (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:

Title Authors Journal
MutY, an adenine glycosylase active on G-A mispairs, has homology to endonuclease III. Michaels ML, Pham L, Nghiem Y, Cruz C, Miller JH Nucleic Acids Res July 11, 1990
Nucleotide sequence of the Escherichia coli micA gene required for A/G-specific mismatch repair: identity of micA and mutY. Tsai-Wu JJ, Radicella JP, Lu AL J Bacteriol March 1, 1991
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
MutY catalytic core, mutant and bound adenine structures define specificity for DNA repair enzyme superfamily. Guan Y, Manuel RC, Arvai AS, Parikh SS, Mol CD, Miller JH, Lloyd S, Tainer JA Nat Struct Biol Dec. 1, 1998
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.