Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad26p

Protein FULL name:

Protein involved in transcription-coupled nucleotide excision repair of UV-induced DNA lesions; recruitment to DNA lesions is dependent on an elongating RNA polymerase II; homolog of human CSB protein (RAD26)


Rad26p (Saccharomyces cerevisiae) is product of expression of RAD26 gene.


Rad26p is involved in:

NER in Saccharomyces cerevisiae


PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_001142). COMPLETENESS: incomplete on both ends.


NCBI GenPept GI number(s): 296146044
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P40352 P40352
PFAM: - P40352 (Link - using uniprot id)
InterPro: - P40352 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MEDKEQQDNAKLENNESLKDLGVNVLSQSSLEEKIANDVTNFSNLQSLQQ
EETRLERSKTALQRYVNKKNHLTRKLNNTTRISVKQNLRDQIKNLQSDDI
ERVLKDIDDIQSRIKELKEQVDQGAENKGSKEGLQRPGETEKEFLIRTGK
ITAFGHKAGFSLDTANREYAKNDEQKDEDFEMATEQMVENLTDEDDNLSD
QDYQMSGKESEDDEEEENDDKILKELEDLRFRGQPGEAKDDGDELYYQER
LKKWVKQRSCGSQRSSDLPEWRRPHPNIPDAKLNSQFKIPGEIYSLLFNY
QKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVL
IVCPATVMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENL
IMNSKPSDFSYEDWKNSTRTKKALESSYHLDKLIDKVVTDGHILITTYVG
LRIHSDKLLKVKWQYAVLDEGHKIRNPDSEISLTCKKLKTHNRIILSGTP
IQNNLTELWSLFDFIFPGKLGTLPVFQQQFVIPINIGGYANATNIQVQTG
YKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLFCKLTKYQRSKYLEF
LHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDTKRHNPDYGDPKRS
GKMQVVKQLLLLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYL
RMDGTTNIKGRQSLVDRFNNESFDVFLLTTRVGGLGVNLTGANRIIIFDP
DWNPSTDMQARERAWRIGQKREVSIYRLMVGGSIEEKIYHRQIFKQFLTN
RILTDPKQKRFFKIHELHDLFSLGGENGYSTEELNEEVQKHTENLKNSKS
EESDDFEQLVNLSGVSKLESFYNGKEKKENSKTEDDRLIEGLLGGESNLE
TVMSHDSVVNSHAGSSSSNIITKEASRVAIEAVNALRKSRKKITKQYEIG
TPTWTGRFGKAGKIRKRDPLKNKLTGSAAILGNITKSQKEASKEARQENY
DDGITFARSKEINSNTKTLENIRAYLQKQNNFFSSSVSILNSIGVSLSDK
EDVIKVRALLKTIAQFDKERKGWVLDEEFRNNNAS

References:

Title Authors Journal
A possible yeast homolog of human active-gene-repairing helicase ERCC6+. Huang ME, Chuat JC, Galibert F Biochem Biophys Res Commun May 1, 1994
RAD26, the functional S. cerevisiae homolog of the Cockayne syndrome B gene ERCC6. van Gool AJ, Verhage R, Swagemakers SM, van de Putte P, Brouwer J, Troelstra C, Bootsma D, Hoeijmakers JH EMBO J Nov. 15, 1994
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X. Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al. EMBO J May 1, 1996
A multidimensional chromatography technology for in-depth phosphoproteome analysis. Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H Mol Cell Proteomics July 1, 2008


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.