Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

MutL

Protein FULL name:

MutL Protein [Escherichia coli].


MutL (Escherichia coli strain K-12 substr. MG1655) is product of expression of mutL gene.


MutL is involved in:

MMR in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a "molecular matchmaker", a protein that promotes the formation of a stable complex between two or more DNA-binding proteins in an ATP-dependent manner without itself being part of the final effector complex. The ATPase activity of mutL is stimulated by DNA.

INTERACTION: P28630:holA; NbExp=2; IntAct=EBI-554913, EBI-549153; P28631:holB; NbExp=2; IntAct=EBI-554913, EBI-549161; P06722:mutH; NbExp=2; IntAct=EBI-554913, EBI-545170; P0A6N1:tufA; NbExp=1; IntAct=EBI-554913, EBI-301077; P03018:uvrD; NbExp=4; IntAct=EBI-554913, EBI-559573;

SIMILARITY: Belongs to the DNA mismatch repair mutL/hexB family.


NCBI GenPept GI number(s): 42067
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P23367 P23367
PFAM: - P23367 (Link - using uniprot id)
InterPro: IPR002099
IPR003594
IPR013507
IPR002099
IPR003594
IPR013507
CATH: - -
SCOP: - -
PDB: 1B62 1B63 1BKN 1X9Z 1B62
1B63
1BKN
1X9Z


Protein sequence:
MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGG
AKLIRIRDNGCGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALA
SISSVSRLTLTSRTAEQQEAWQAYAEGRDMNVTVKPAAHPVGTTLEVLDL
FYNTPARRKFLRTEKTEFNHIDEIIRRIALARFDVTINLSHNGKIVRQYR
AVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWVADPNHTTPAL
AEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVD
VNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQLETPLPLDDEPQPAPRS
IPENRVAAGRNHFAEPAAREPVAPRYTPAPASGSRPAAPWPNAQPGYQKQ
QGEVYRQLLQTPAPMQKLKAPEPQEPALAANSQSFGRVLTIVHSDCALLE
RDGNISLLSLPVAERWLRQAQLTPGEAPVCAQPLLIPLRLKVSAEEKSAL
EKAQSALAELGIDFQSDAQHVTIRAVPLPLRQQNLQILIPELIGYLAKQS
VFEPGNIAQWIARNLMSEHAQWSMAQAITLLADVERLCPQLVKTPPGGLL
QSVDLHPAIKALKDE

MutL (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
Solved crystal structures:
References:

Title Authors Journal
Structure of Escherichia coli K-12 miaA and characterization of the mutator phenotype caused by miaA insertion mutations. Connolly DM, Winkler ME J Bacteriol March 1, 1991
Nonconserved segment of the MutL protein from Escherichia coli K-12 and Salmonella typhimurium. Tsui HT, Mandavilli BS, Winkler ME Nucleic Acids Res May 11, 1992
The mutL repair gene of Escherichia coli K-12 forms a superoperon with a gene encoding a new cell-wall amidase. Tsui HC, Zhao G, Feng G, Leung HC, Winkler ME Mol Microbiol Feb. 1, 1994
Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR Nucleic Acids Res June 25, 1995
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Crystal structure and ATPase activity of MutL: implications for DNA repair and mutagenesis. Ban C, Yang W Cell Nov. 13, 1998
Transformation of MutL by ATP binding and hydrolysis: a switch in DNA mismatch repair. Ban C, Junop M, Yang W Cell April 2, 1999
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.