Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

RBBP8

Protein FULL name:

retinoblastoma-binding protein 8 isoform a [Homo sapiens].


RBBP8 (Homo sapiens) is product of expression of RBBP8 gene.






FUNCTION: May modulate the functions ascribed to BRCA1 in transcriptional regulation, DNA repair, and/or cell cycle checkpoint control.

SUBUNIT: Interacts with CTBP, with the C-terminal (BRCT) domains of BRCA1, and with the retinoblastoma protein.

INTERACTION: P38398:BRCA1; NbExp=5; IntAct=EBI-1263531, EBI-349905; Q6UWZ7:FAM175A; NbExp=1; IntAct=EBI-1263531, EBI-1263451;

SUBCELLULAR LOCATION: Nucleus. Note=Predominantly nuclear.

PTM: Phosphorylated upon DNA damage, probably by ATM or ATR. Hyperphosphorylation upon ionizing radiation results in dissociation from BRCA1.

PTM: Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation (Probable).

WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; [LINK]


NCBI GenPept GI number(s): 4506441
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q99708 Q99708
PFAM: - Q99708 (Link - using uniprot id)
InterPro: - Q99708 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERI
LDAQRLEEFFTKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMR
KKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQKIENDQQHQA
AELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCA
NEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSS
FNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTR
NTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSL
LQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQ
SSNKQILINKNISESLGEQNRTEYGKDSNTDKHLEPLKSLGGRTSKRKKT
EEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKPLDLSDRFSAI
QRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSP
GEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVL
DDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSF
ENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVL
LKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADE
EEELSTATKKLHTHGDKQDKVKQKAFVEPYFKGDERETSLQNFPHIEVVR
KKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRFRYIPPNTPEN
FWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT

RBBP8 (Homo sapiens) is able to recognize following damages:
RBBP8 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
Interaction between a cellular protein that binds to the C-terminal region of adenovirus E1A (CtBP) and a novel cellular protein is disrupted by E1A through a conserved PLDLS motif. Schaeper U, Subramanian T, Lim L, Boyd JM, Chinnadurai G J Biol Chem April 10, 1998
Molecular cloning and characterization of a novel retinoblastoma-binding protein. Fusco C, Reymond A, Zervos AS Genomics Aug. 1, 1998
Nuclear localization and cell cycle-specific expression of CtIP, a protein that associates with the BRCA1 tumor suppressor. Yu X, Baer R J Biol Chem June 16, 2000
Functional link of BRCA1 and ataxia telangiectasia gene product in DNA damage response. Li S, Ting NS, Zheng L, Chen PL, Ziv Y, Shiloh Y, Lee EY, Lee WH Nature July 13, 2000
SIAH-1 interacts with CtIP and promotes its degradation by the proteasome pathway. Germani A, Prabel A, Mourah S, Podgorniak MP, Di Carlo A, Ehrlich R, Gisselbrecht S, Varin-Blank N, Calvo F, Bruzzoni-Giovanelli H Oncogene Dec. 4, 2003
Large-scale characterization of HeLa cell nuclear phosphoproteins. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP Proc Natl Acad Sci U S A Aug. 17, 2004
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science May 25, 2007
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal Jan. 1, 2009
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem June 1, 2009


Last modification of this entry: Oct. 11, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.