Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

MutH

Protein FULL name:

DNA mismatch repair protein mutH, Methyl-directed mismatch repair protein.,


MutH (Escherichia coli strain K-12 substr. MG1655) is product of expression of mutH gene.


MutH is involved in:

MMR in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: Sequence-specific endonuclease that cleaves unmethylated GATC sequences. It is involved in DNA mismatch repair.

INTERACTION: P76217:astD; NbExp=1; IntAct=EBI-545170, EBI-545161; P23367:mutL; NbExp=2; IntAct=EBI-545170, EBI-554913;

SUBCELLULAR LOCATION: Cytoplasm.

SIMILARITY: Belongs to the mutH family.


NCBI GenPept GI number(s): 730086
42065
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P06722 P06722
PFAM: PF02976
PF02976
InterPro: IPR004230
IPR018140
IPR011335
IPR004230
IPR018140
IPR011335
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSQPRPLLSPPETEEQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGW
IGVLLEIWLGASAGSKPEQDFAALGVELKTIPVDSLGRPLETTFVCVAPL
TGNSGVTWETSHVRHKLKRVLWIPVEGERSIPLAQRRVGSPLLWSPNEEE
DRQLREDWEELMDMIVLGQVERITARHGEYLQIRPKAANAKALTEAIGAR
GERILTLPRGFYLKKNFTSALLARHFLIQ

MutH (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:

Title Authors Journal
Nucleotide sequence of the Escherichia coli mutH gene. Grafstrom RH, Hoess RH Nucleic Acids Res April 10, 1987
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Structural basis for MutH activation in E.coli mismatch repair and relationship of MutH to restriction endonucleases. Ban C, Yang W EMBO J March 2, 1998
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 13, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.