Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Fanci

Protein FULL name:

Fanconi anemia group I protein homolog [Mus musculus].


Fanci (Mus musculus) is product of expression of Fanci gene.






FUNCTION: Required for maintenance of chromosomal stability. Involved in the repair of DNA double-strand breaks by homologous recombination and in the repair of DNA cross-links. Participates in S phase and G2 phase checkpoint activation upon DNA damage. Promotes FANCD2 ubiquitination and recruitment to DNA repair sites (By similarity).

SUBUNIT: Interacts directly with FANCD2 (By similarity).

SUBCELLULAR LOCATION: Nucleus (By similarity). Note=Concentrates in nuclear foci upon genotoxic stress (By similarity).

DOMAIN: The C-terminal 30 residues are probably required for function in DNA repair (By similarity).

PTM: Monoubiquitinated on Lys-522 during S phase and upon genotoxic stress. Deubiquitinated by USP1 as cells enter G2/M, or once DNA repair is completed. Monoubiquitination requires the FANCA-FANCB-FANCC-FANCE-FANCF-FANCG-FANCM complex. Ubiquitination is required for binding to chromatin, DNA repair, and normal cell cycle progression (By similarity).

PTM: Phosphorylated in response to DNA damage by ATM and/or ATR.

SEQUENCE CAUTION: Sequence=BAC39475.1; Type=Erroneous initiation;


NCBI GenPept GI number(s): 126722700
Species: Mus musculus

Links to other databases:

Database ID Link
Uniprot Q8K368 Q8K368
PFAM: - Q8K368 (Link - using uniprot id)
InterPro: - Q8K368 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDLKILSLATDKTTDKLQEFLQTLKDDDLASLLQNQAVKGRAVGTLLRAV
LKGSPCSEEDGALRRYKIYSCCIQLVESGDLQQDVASEIIGLLMLEVHHF
PGPLLVDLASDFVGAVREDRLVNGKSLELLPIILTALATKKEVLACGKGD
LNGEEYKRQLIDTLCSVRWPQRYMIQLTSVFKDVCLTPEEMNLVVAKVLT
MFSKLNLQEIPPLVYQLLVLSSKGSRRSVLDGIIAFFRELDKQHREEQSS
DELSELITAPADELYHVEGTVILHIVFAIKLDCELGRELLKHLKAGQQGD
PSKCLCPFSIALLLSLTRIQRFEEQVFDLLKTSVVKSFKDLQLLQGSKFL
QTLVPQRTCVSTMILEVVRNSVHSWDHVTQGLIEFGFILMDSYGPKKILD
GKAVEIGTSLSKMTNQHACKLGANILLETFKIHEMIRQEILEQVLNRVVT
RTSSPINHFLDLFSDIIMYAPLILQNCSKVTETFDYLTFLPLQTVQGLLK
AVQPLLKISMSMRDSLILVLRKAMFASQLDARKSAVAGFLLLLKNFKVLG
SLPSSQCTQSIGVTQVRVDVHSRYSAVANETFCLEIIDSLKRSLGQQADI
RLMLYDGFYDVLRRNSQLASSIMQTLFSQLKQFYEPEPDLLPPLKLGACV
LTQGSQIFLQEPLDHLLSCIQHCLAWYKSRVVPLQQGDEGEEEEEELYSE
LDDMLESITVRMIKSELEDFELDKSADFSQNTNVGIKNNICACLIMGVCE
VLMEYNFSISNFSKSKFEEILSLFTCYKKFSDILSEKAGKGKAKMTSKVS
DSLLSLKFVSDLLTALFRDSIQSHEESLSVLRSSGEFMHYAVNVTLQKIQ
QLIRTGHVSGPDGQNPDKIFQNLCDITRVLLWRYTSIPTSVEESGKKEKG
KSISLLCLEGLQKTFSVVLQFYQPKVQQFLQALDVMGTEEEEAGVTVTQR
ASFQIRQFQRSLLNLLSSEEDDFNSKEALLLIAVLSTLSRLLEPTSPQFV
QMLSWTSKICKEYSQEDASFCKSLMNLFFSLHVLYKSPVTLLRDLSQDIH
GQLGDIDQDVEIEKTDHFAVVNLRTAAPTVCLLVLSQAEKVLEEVDWLIA
KIKGSANQETLSDKVTPEDASSQAVPPTLLIEKAIVMQLGTLVTFFHELV
QTALPSGSCVDTLLKGLSKIYSTLTAFVKYYLQVCQSSRGIPNTVEKLVK
LSGSHLTPVCYSFISYVQNKSSDAPKCSEKEKAAVSTTMAKVLRETKPIP
NLVFAIEQYEKFLIQLSKKSKVNLMQHMKLSTSRDFKIKGSVLDMVLRED
EEDENEEGTASAHTQQDREPAKKRRKKCLS

Fanci (Mus musculus) belongs to following protein families:
References:

Title Authors Journal
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004
The transcriptional landscape of the mammalian genome. Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y Science Sept. 2, 2005
Identification of the FANCI protein, a monoubiquitinated FANCD2 paralog required for DNA repair. Smogorzewska A, Matsuoka S, Vinciguerra P, McDonald ER 3rd, Hurov KE, Luo J, Ballif BA, Gygi SP, Hofmann K, D'Andrea AD, Elledge SJ Cell April 20, 2007
ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ Science May 25, 2007
FANCI is a second monoubiquitinated member of the Fanconi anemia pathway. Sims AE, Spiteri E, Sims RJ 3rd, Arita AG, Lach FP, Landers T, Wurm M, Freund M, Neveling K, Hanenberg H, Auerbach AD, Huang TT Nat Struct Mol Biol June 1, 2007
Lineage-specific biology revealed by a finished genome assembly of the mouse. Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL, DiCuccio M, Hlavina W, Kapustin Y, Meric P, Maglott D, Birtle Z, Marques AC, Graves T, Zhou S, Teague B, Potamousis K, Churas C, Place M, Herschleb J, Runnheim R, Forrest D, Amos-Landgraf J, Schwartz DC, Cheng Z, Lindblad-Toh K, Eichler EE, Ponting CP PLoS Biol May 5, 2009


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.