Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

ALKBH2

Protein FULL name:

alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 [Homo sapiens].


ALKBH2 (Homo sapiens) is product of expression of ALKBH2 gene.


ALKBH2 is involved in:

DRR in Homo sapiens

Keywords:



FUNCTION: Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1- ethenoadenine (in vitro). Has strong preference for double- stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.

COFACTOR: Binds 1 Fe(2+) ion per subunit.

ENZYME REGULATION: Activated by ascorbate and magnesium ions.

SUBCELLULAR LOCATION: Nucleus. Note=Detected in replication foci during S-phase.

TISSUE SPECIFICITY: Detected in colon, small intestine, ovary, testis, prostate, skeletal muscle, heart, liver and urinary bladder.

SIMILARITY: Belongs to the alkB family.

SIMILARITY: Contains 1 Fe2OG dioxygenase domain.


NCBI GenPept GI number(s): 48717226
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q6NS38 Q6NS38
PFAM: - Q6NS38 (Link - using uniprot id)
InterPro: - Q6NS38 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGG
HSAGPSWRHIRAEGLDCSYTVLFGKAEADEIFQELEKEVEYFTGALARVQ
VFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTG
QTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHK
DSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVN
LTFRKILLTKK

ALKBH2 (Homo sapiens) is able to recognize following damages:
ALKBH2 (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
Reversal of DNA alkylation damage by two human dioxygenases. Duncan T, Trewick SC, Koivisto P, Bates PA, Lindahl T, Sedgwick B Proc Natl Acad Sci U S A Dec. 24, 2002
Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA. Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE Nature Jan. 20, 2003
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J Genome Res Oct. 1, 2004
Repair of methylation damage in DNA and RNA by mammalian AlkB homologues. Lee DH, Jin SG, Cai S, Chen Y, Pfeifer GP, O'Connor TR J Biol Chem Nov. 25, 2005
Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA. Yang CG, Yi C, Duguid EM, Sullivan CT, Jian X, Rice PA, He C Nature April 24, 2008
AlkB homologue 2-mediated repair of ethenoadenine lesions in mammalian DNA. Ringvoll J, Moen MN, Nordstrand LM, Meira LB, Pang B, Bekkelund A, Dedon PC, Bjelland S, Samson LD, Falnes PO, Klungland A Cancer Res June 1, 2008
Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system. Lu L, Yi C, Jian X, Zheng G, He C Nucleic Acids Res July 1, 2010


Last modification of this entry: Nov. 11, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.