Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ssb

Protein FULL name:

single-stranded DNA-binding protein [Escherichia coli str. K-12 substr. MG1655].


Ssb (Escherichia coli strain K-12 substr. MG1655) is product of expression of ssb gene.


Ssb is involved in:

DDS in Escherichia coli strain K-12 substr. MG1655
     





FUNCTION: This protein is essential for replication of the chromosomes and its single-stranded DNA phages. It is also involved in DNA recombination and repair.

SUBUNIT: Homotetramer.

PTM: Phosphorylated on tyrosine residue(s).

SIMILARITY: Contains 1 SSB domain.


NCBI GenPept GI number(s): 16131885
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P0AGE0 P0AGE0
PFAM: - P0AGE0 (Link - using uniprot id)
InterPro: - P0AGE0 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMK
EQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTT
EVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSG
GAQSRPQQSAPAAPSNEPPMDFDDDIPF

References:

Title Authors Journal
Sequences of the ssb gene and protein. Sancar A, Williams KR, Chase JW, Rupp WD Proc Natl Acad Sci U S A July 1, 1981
Biological activity and a partial amino-acid sequence of Escherichia coli DNA-binding protein I isolated from overproducing cells. Beyreuther K, Berthold-Schmidt V, Geider K Eur J Biochem April 1, 1982
F sex factor encodes a single-stranded DNA binding protein (SSB) with extensive sequence homology to Escherichia coli SSB. Chase JW, Merrill BM, Williams KR Proc Natl Acad Sci U S A Sept. 1, 1983
Characterization of the Escherichia coli SSB-113 mutant single-stranded DNA-binding protein. Cloning of the gene, DNA and protein sequence analysis, high pressure liquid chromatography peptide mapping, and DNA-binding studies. Chase JW, L'Italien JJ, Murphy JB, Spicer EK, Williams KR J Biol Chem Feb. 25, 1984
Characterization of the structural and functional defect in the Escherichia coli single-stranded DNA binding protein encoded by the ssb-1 mutant gene. Expression of the ssb-1 gene under lambda pL regulation. Williams KR, Murphy JB, Chase JW J Biol Chem Oct. 10, 1984
Tryptophan 54 and phenylalanine 60 are involved synergistically in the binding of E. coli SSB protein to single-stranded polynucleotides. Casas-Finet JR, Khamis MI, Maki AH, Chase JW FEBS Lett Aug. 17, 1987
The single-stranded DNA-binding protein of Escherichia coli. Meyer RR, Laine PS Microbiol Rev Dec. 1, 1990
Monomers of the Escherichia coli SSB-1 mutant protein bind single-stranded DNA. Bujalowski W, Lohman TM J Mol Biol Feb. 5, 1991
Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL Nucleic Acids Res Nov. 25, 1993
Identification and characterization of ssb and uup mutants with increased frequency of precise excision of transposon Tn10 derivatives: nucleotide sequence of uup in Escherichia coli. Reddy M, Gowrishankar J J Bacteriol May 1, 1997
Crystal structure of the homo-tetrameric DNA binding domain of Escherichia coli single-stranded DNA-binding protein determined by multiwavelength x-ray diffraction on the selenomethionyl protein at 2.9-A resolution. Raghunathan S, Ricard CS, Lohman TM, Waksman G Proc Natl Acad Sci U S A June 24, 1997
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Structure of the DNA binding domain of E. coli SSB bound to ssDNA. Raghunathan S, Kozlov AG, Lohman TM, Waksman G Nat Struct Biol Aug. 1, 2000
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006
Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine. Mijakovic I, Petranovic D, Macek B, Cepo T, Mann M, Davies J, Jensen PR, Vujaklija D Nucleic Acids Res Jan. 1, 2006


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.