Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ntg1p

Protein FULL name:

DNA N-glycosylase and apurinic/apyrimidinic (AP) lyase involved in base excision repair; acts in both nucleus and mitochondrion; creates a double-strand break at mtDNA origins that stimulates replication in response to oxidative stress


Protein SHORT name:

NTG1, FUN33, SCR1


Ntg1p (Saccharomyces cerevisiae) is product of expression of NTG1 gene.


Ntg1p is involved in:

BER in Saccharomyces cerevisiae

Keywords:



FUNCTION: Excision repair N-glycosylase involved in the repair of DNA base damage in the mitochondria. NTG1 can use dihydrothymine, urea, and uracil glycol are substrates.

SUBCELLULAR LOCATION: Mitochondrion. Note=Mitochondrial transmembrane space or matrix.

SIMILARITY: Belongs to the nth/mutY family.


NCBI GenPept GI number(s): 6319304
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P31378 P31378
PFAM: - P31378 (Link - using uniprot id)
InterPro: - P31378 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MQKISKYSSMAILRKRPLVKTETGPESELLPEKRTKIKQEEVVPQPVDID
WVKSLPNKQYFEWIVVRNGNVPNRWATPLDPSILVTPASTKVPYKFQETY
ARMRVLRSKILAPVDIIGGSSIPVTVASKCGISKEQISPRDYRLQVLLGV
MLSSQTKDEVTAMAMLNIMRYCIDELHSEEGMTLEAVLQINETKLDELIH
SVGFHTRKAKYILSTCKILQDQFSSDVPATINELLGLPGVGPKMAYLTLQ
KAWGKIEGICVDVHVDRLTKLWKWVDAQKCKTPDQTRTQLQNWLPKGLWT
EINGLLVGFGQIITKSRNLGDMLQFLPPDDPRSSLDWDLQSQLYKEIQQN
IMSYPKWVKYLEGKRELNVEAEINVKHEEKTVEETMVKLENDISVKVED

Ntg1p (Saccharomyces cerevisiae) is able to recognize following damages:
Ntg1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Sequencing of chromosome I from Saccharomyces cerevisiae: analysis of a 32 kb region between the LTE1 and SPO7 genes. Ouellette BF, Clark MW, Keng T, Storms RK, Zhong W, Zeng B, Fortin N, Delaney S, Barton A, Kaback DB, et al. Genome Jan. 1, 1993
Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: analysis of the genes in the FUN38-MAK16-SPO7 region. Barton AB, Kaback DB J Bacteriol April 1, 1994
The nucleotide sequence of chromosome I from Saccharomyces cerevisiae. Bussey H, Kaback DB, Zhong W, Vo DT, Clark MW, Fortin N, Hall J, Ouellette BF, Keng T, Barton AB, et al. Proc Natl Acad Sci U S A April 25, 1995
Saccharomyces cerevisiae Ntg1p and Ntg2p: broad specificity N-glycosylases for the repair of oxidative DNA damage in the nucleus and mitochondria. You HJ, Swanson RL, Harrington C, Corbett AH, Jinks-Robertson S, Senturker S, Wallace SS, Boiteux S, Dizdaroglu M, Doetsch PW Biochemistry Aug. 31, 1999


Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.