Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
POLM |
Protein FULL name:
DNA polymerase mu,
Protein SHORT name:
Pol Mu
POLM (Homo sapiens) is product of expression of POLM gene.
POLM is involved in:
NHEJ in Homo sapiens TLS in Homo sapiens
Keywords:
- V(D)J recombination
- non-homologues end-joining (NHEJ)
- DNA damage tolerance pathway (TLS)
- response to DNA damage
- DNA polymerase
FUNCTION: Seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
COFACTOR: Magnesium (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity).
TISSUE SPECIFICITY: Expressed in a number of tissues. Abundant in thymus.
SIMILARITY: Belongs to the DNA polymerase type-X family.
SIMILARITY: Contains 1 BRCT domain.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
17366980 7019493 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9NP87 |
Q9NP87 |
| PFAM: |
PF10391 |
PF10391 |
| InterPro: |
IPR001357 IPR002054 IPR010996 IPR001726 IPR019843 IPR018944 IPR022312 |
IPR001357 IPR002054 IPR010996 IPR001726 IPR019843 IPR018944 IPR022312 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MLPKRRRARVGSPSGDAASSTPPSTRFPGVAIYLVEPRMGRSRRAFLTGL ARSKGFRVLDACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALL DISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLT HHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQ GLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKT ADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRSDVDALQQ VVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRV MCRLQDQGLILYHQHQHSCCESPTRLAQQSHMDAFERSFCIFRLPQPPGA AVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRK EKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA |
POLM (Homo sapiens) is able to recognize following damages:
POLM (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| DNA polymerase mu (Pol mu), homologous to TdT, could act as a DNA mutator in eukaryotic cells. | Dominguez O, Ruiz JF, Lain de Lera T, Garcia-Diaz M, Gonzalez MA, Kirchhoff T, Martinez-A C, Bernad A, Blanco L | EMBO J April 3, 2000 |
| Two novel human and mouse DNA polymerases of the polX family. | Aoufouchi S, Flatter E, Dahan A, Faili A, Bertocci B, Storck S, Delbos F, Cocea L, Gupta N, Weill JC, Reynaud CA | Nucleic Acids Res Sept. 15, 2000 |
| A quantitative atlas of mitotic phosphorylation. | Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP | Proc Natl Acad Sci U S A Aug. 5, 2008 |
| Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. | Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK | Sci Signal Jan. 1, 2009 |
| Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. | Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S | Anal Chem June 1, 2009 |
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|