Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

POLM

Protein FULL name:

DNA polymerase mu,


Protein SHORT name:

Pol Mu


POLM (Homo sapiens) is product of expression of POLM gene.


POLM is involved in:

NHEJ in Homo sapiens TLS in Homo sapiens
     


Keywords:



FUNCTION: Seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

COFACTOR: Magnesium (By similarity).

SUBCELLULAR LOCATION: Nucleus (By similarity).

TISSUE SPECIFICITY: Expressed in a number of tissues. Abundant in thymus.

SIMILARITY: Belongs to the DNA polymerase type-X family.

SIMILARITY: Contains 1 BRCT domain.

WEB RESOURCE: Name=NIEHS-SNPs; [LINK]


NCBI GenPept GI number(s): 17366980
7019493
Species: Homo sapiens

Links to other databases:

Database ID Link
Uniprot Q9NP87 Q9NP87
PFAM: PF10391
PF10391
InterPro: IPR001357
IPR002054
IPR010996
IPR001726
IPR019843
IPR018944
IPR022312
IPR001357
IPR002054
IPR010996
IPR001726
IPR019843
IPR018944
IPR022312
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MLPKRRRARVGSPSGDAASSTPPSTRFPGVAIYLVEPRMGRSRRAFLTGL
ARSKGFRVLDACSSEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALL
DISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLT
HHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQ
GLPHFGEHSSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKT
ADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRSDVDALQQ
VVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRV
MCRLQDQGLILYHQHQHSCCESPTRLAQQSHMDAFERSFCIFRLPQPPGA
AVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRK
EKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA

POLM (Homo sapiens) is able to recognize following damages:
POLM (Homo sapiens) belongs to following protein families:
References:

Title Authors Journal
DNA polymerase mu (Pol mu), homologous to TdT, could act as a DNA mutator in eukaryotic cells. Dominguez O, Ruiz JF, Lain de Lera T, Garcia-Diaz M, Gonzalez MA, Kirchhoff T, Martinez-A C, Bernad A, Blanco L EMBO J April 3, 2000
Two novel human and mouse DNA polymerases of the polX family. Aoufouchi S, Flatter E, Dahan A, Faili A, Bertocci B, Storck S, Delbos F, Cocea L, Gupta N, Weill JC, Reynaud CA Nucleic Acids Res Sept. 15, 2000
A quantitative atlas of mitotic phosphorylation. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP Proc Natl Acad Sci U S A Aug. 5, 2008
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK Sci Signal Jan. 1, 2009
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S Anal Chem June 1, 2009


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.