Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ung1p

Ung1p (Saccharomyces cerevisiae) is product of expression of UNG1 gene.


Ung1p is involved in:

BER in Saccharomyces cerevisiae

Keywords:



FUNCTION: Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

CATALYTIC ACTIVITY: Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.

SUBCELLULAR LOCATION: Nucleus. Mitochondrion.

MISCELLANEOUS: Present with 4820 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the uracil-DNA glycosylase family.


NCBI GenPept GI number(s): 6323620
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P12887 P12887
PFAM: - P12887 (Link - using uniprot id)
InterPro: - P12887 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MWCMRRLPTNSVMTVARKRKQTTIEDFFGTKKSTNEAPNKKGKSGATFMT
ITNGAAIKTETKAVAKEANTDKYPANSNAKDVYSKNLSSNLRTLLSLELE
TIDDSWFPHLMDEFKKPYFVKLKQFVTKEQADHTVFPPAKDIYSWTRLTP
FNKVKVVIIGQDPYHNFNQAHGLAFSVKPPTPAPPSLKNIYKELKQEYPD
FVEDNKVGDLTHWASQGVLLLNTSLTVRAHNANSHSKHGWETFTKRVVQL
LIQDREADGKSLVFLLWGNNAIKLVESLLGSTSVGSGSKYPNIMVMKSVH
PSPLSASRGFFGTNHFKMINDWLYNTRGEKMIDWSVVPGTSLREVQEANA
RLESESKDP

Ung1p (Saccharomyces cerevisiae) is able to recognize following damages:
Ung1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Molecular cloning and primary structure of the uracil-DNA-glycosylase gene from Saccharomyces cerevisiae. Percival KJ, Klein MB, Burgers PM J Biol Chem Jan. 15, 1989
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.