Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
CDK7 (CDKs) |
Protein FULL name:
Cell division protein kinase 7, CDK-activating kinase, CAK1, TFIIH basal transcription factor complex kinase subunit, 39 kDa protein kinase, p39 Mo15, STK1.,
Protein SHORT name:
CAK, CDKs
CDK7 (CDKs) (Homo sapiens) is product of expression of CDK7 gene.
CDK7 (CDKs) is involved in:
DDS in Homo sapiens
FUNCTION: Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between two subsequent phases in the cell cycle. CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex, a serine-threonine kinase. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
CATALYTIC ACTIVITY: ATP + [DNA-directed RNA polymerase] = ADP + [DNA-directed RNA polymerase] phosphate.
ENZYME REGULATION: Inactivated by phosphorylation.
SUBUNIT: Associates primarily with cyclin H and MAT1 to form the CAK complex. CAK can further associate with the core-TFIIH to form the TFIIH basal transcription factor. Interacts with PUF60.
SUBCELLULAR LOCATION: Nucleus.
TISSUE SPECIFICITY: Ubiquitous.
PTM: Phosphorylation of Ser-164 during mitosis inactivates the enzyme.
PTM: Phosphorylation of Thr-170 is required for activity.
SIMILARITY: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
SIMILARITY: Contains 1 protein kinase domain.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
1705722 4502743 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | P50613 |
P50613 |
| PFAM: |
PF00069 |
PF00069 |
| InterPro: |
IPR011009 IPR000719 IPR017441 IPR017442 IPR008271 IPR002290 |
IPR011009 IPR000719 IPR017441 IPR017442 IPR008271 IPR002290 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSE AKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEV IIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGV LKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVG CILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFK SFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
CDK7 (CDKs) (Homo sapiens) is able to recognize following damages:
CDK7 (CDKs) (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Two novel human serine/threonine kinases with homologies to the cell cycle regulating Xenopus MO15, and NIMA kinases: cloning and characterization of their expression pattern. | Levedakou EN, He M, Baptist EW, Craven RJ, Cance WG, Welcsh PL, Simmons A, Naylor SL, Leach RJ, Lewis TB, et al. | Oncogene July 1, 1994 |
| Molecular cloning of the human CAK1 gene encoding a cyclin-dependent kinase-activating kinase. | Wu L, Yee A, Liu L, Carbonaro-Hall D, Venkatesan N, Tolo VT, Hall FL | Oncogene July 1, 1994 |
| A novel cyclin associates with MO15/CDK7 to form the CDK-activating kinase. | Fisher RP, Morgan DO | Cell Aug. 26, 1994 |
| Cell cycle analysis of the activity, subcellular localization, and subunit composition of human CAK (CDK-activating kinase). | Tassan JP, Schultz SJ, Bartek J, Nigg EA | J Cell Biol Oct. 1, 1994 |
| Cloning, expression and subcellular localization of the human homolog of p40MO15 catalytic subunit of cdk-activating kinase. | Darbon JM, Devault A, Taviaux S, Fesquet D, Martinez AM, Galas S, Cavadore JC, Doree M, Blanchard JM | Oncogene Nov. 1, 1994 |
| The molecular mechanism of mitotic inhibition of TFIIH is mediated by phosphorylation of CDK7. | Akoulitchev S, Reinberg D | Genes Dev Nov. 15, 1998 |
| Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. | Kershnar E, Wu SY, Chiang CM | J Biol Chem Dec. 18, 1998 |
| Reconstitution of the transcription factor TFIIH: assignment of functions for the three enzymatic subunits, XPB, XPD, and cdk7. | Tirode F, Busso D, Coin F, Egly JM | Mol Cell Feb. 1, 1999 |
| The FBP interacting repressor targets TFIIH to inhibit activated transcription. | Liu J, He L, Collins I, Ge H, Libutti D, Li J, Egly JM, Levens D | Mol Cell Jan. 1, 2000 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| The crystal structure of human CDK7 and its protein recognition properties. | Lolli G, Lowe ED, Brown NR, Johnson LN | Structure Nov. 1, 2004 |
| Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. | Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H | Mol Cell Proteomics March 1, 2007 |
| Patterns of somatic mutation in human cancer genomes. | Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR | Nature March 8, 2007 |
| Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. | Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd | J Proteome Res March 1, 2008 |
| A quantitative atlas of mitotic phosphorylation. | Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP | Proc Natl Acad Sci U S A Aug. 5, 2008 |
| Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. | Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M | Mol Cell Aug. 8, 2008 |
| Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. | Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK | Sci Signal Jan. 1, 2009 |
| Large-scale proteomics analysis of the human kinome. | Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H | Mol Cell Proteomics July 1, 2009 |
Last modification of this entry: Oct. 10, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|