Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
UvrA |
Protein FULL name:
ATPase and DNA damage recognition protein of nucleotide excision repair excinuclease UvrABC [Escherichia coli str. K-12 substr. MG1655].
UvrA (Escherichia coli strain K-12 substr. MG1655) is product of expression of uvrA gene.
UvrA is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
- UvrA2UvrB complex joins damaged DNA with MFD [TCR] in Escherichia coli strain K-12 substr. MG1655
- UvrA2UvrB complex joins damaged strand in Escherichia coli strain K-12 substr. MG1655
- UvrA2 leaves stable complex of UvrB and DNA in Escherichia coli strain K-12 substr. MG1655
Keywords:
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- global genome repair NER (GGR-NER)
FUNCTION: The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of 2 uvrA and 2 uvrB subunits scans DNA for abnormalities. When the presence of a lesion has been verified by uvrB, the uvrA molecules dissociate (By similarity).
SUBUNIT: Forms a heterotetramer with uvrB during the search for lesions (By similarity).
INTERACTION: P00864:ppc; NbExp=1; IntAct=EBI-552091, EBI-1133741; P07648:recC; NbExp=1; IntAct=EBI-552091, EBI-556823;
SUBCELLULAR LOCATION: Cytoplasm (By similarity).
MISCELLANEOUS: Binds about 2 zinc atoms/molecule.
SIMILARITY: Belongs to the ABC transporter superfamily. UvrA family.
SIMILARITY: Contains 2 ABC transporter domains.
| NCBI GenPept GI number(s): |
16131884 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A698 |
P0A698 |
| PFAM: | - |
P0A698 (Link - using uniprot id) |
| InterPro: | - |
P0A698 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | 1x9z |
1x9z |
Protein sequence:
|
MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDTLYAEGQ RRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGT ITEIHDYLRLLFARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLML LAPIIKERKGEHTKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTI EVVVDRFKVRDDLTQRLAESFETALELSGGTAVVADMDDPKAEELLFSAN FACPICGYSMRELEPRLFSFNNPAGACPTCDGLGVQQYFDPDRVIQNPEL SLAGGAIRGWDRRNFYYFQMLKSLADHYKFDVEAPWGSLSANVHKVVLYG SGKENIEFKYMNDRGDTSIRRHPFEGVLHNMERRYKETESSAVREELAKF ISNRPCASCEGTRLRREARHVYVENTPLPAISDMSIGHAMEFFNNLKLAG QRAKIAEKILKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQ IGAGLVGVMYVLDEPSIGLHQRDNERLLGTLIHLRDLGNTVIVVEHDEDA IRAADHVIDIGPGAGVHGGEVVAEGPLEAIMAVPESLTGQYMSGKRKIEV PKKRVPANPEKVLKLTGARGNNLKDVTLTLPVGLFTCITGVSGSGKSTLI NDTLFPIAQRQLNGATIAEPAPYRDIQGLEHFDKVIDIDQSPIGRTPRSN PATYTGVFTPVRELFAGVPESRARGYTPGRFSFNVRGGRCEACQGDGVIK VEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFF DAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTG QTLYILDEPTTGLHFADIQQLLDVLHKLRDQGNTIVVIEHNLDVIKTADW IVDLGPEGGSGGGEILVSGTPETVAECEASHTARFLKPML |
Solved crystal structures:
References:
| Title | Authors | Journal |
| LexA protein inhibits transcription of the E. coli uvrA gene in vitro. | Sancar A, Sancar GB, Rupp WD, Little JW, Mount DW | Nature July 1, 1982 |
| In vivo regulation of the uvrA gene: role of the "-10" and "-35" promoter regions. | Backendorf C, Brandsma JA, Kartasova T, van de Putte P | Nucleic Acids Res Sept. 10, 1983 |
| Sequences of Escherichia coli uvrA gene and protein reveal two potential ATP binding sites. | Husain I, Van Houten B, Thomas DC, Sancar A. | J Biol Chem. April 15, 1986 |
| Evidence from extended X-ray absorption fine structure and site-specific mutagenesis for zinc fingers in UvrA protein of Escherichia coli. | Navaratnam S, Myles GM, Strange RW, Sancar A | J Biol Chem Sept. 25, 1989 |
| Isolation and characterization of functional domains of UvrA. | Myles GM, Sancar A | Biochemistry April 23, 1991 |
| Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes. | Blattner FR, Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL | Nucleic Acids Res Nov. 25, 1993 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|