Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
UvrB |
Protein FULL name:
UvrABC system protein B, Excinuclease ABC subunit B.,
Protein SHORT name:
uvrB
UvrB (Escherichia coli strain K-12 substr. MG1655) is product of expression of uvrB gene.
UvrB is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
- UvrD joins the protein-DNA complex in Escherichia coli strain K-12 substr. MG1655
- UvrA2, MFD leave stable complex of UvrB and DNA in Escherichia coli strain K-12 substr. MG1655
- UvrA2UvrB complex joins damaged DNA with MFD [TCR] in Escherichia coli strain K-12 substr. MG1655
- UvrA2UvrB complex joins damaged strand in Escherichia coli strain K-12 substr. MG1655
- oligomer and UvrC leaves DNA in ATP-dependent reaction in Escherichia coli strain K-12 substr. MG1655
- UvrA2 leaves stable complex of UvrB and DNA in Escherichia coli strain K-12 substr. MG1655
- UvrC joins UvrB-DNA complex in Escherichia coli strain K-12 substr. MG1655
Keywords:
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- response to DNA damage
- global genome repair NER (GGR-NER)
FUNCTION: The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 uvrA and 2 uvrB subunits scans DNA for abnormalities. Upon binding of the uvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one uvrB monomer. DNA wrap is dependent on ATP binding by uvrB and probably causes local melting of the DNA helix, facilitating insertion of uvrB beta-hairpin between the DNA strands. Then uvrB probes one DNA strand for the presence of a lesion. If a lesion is found the uvrA subunits dissociate and the uvrB-DNA preincision complex is formed. This complex is subsequently bound by uvrC and the second uvrB is released. If no lesion is found, the DNA wraps around the other uvrB subunit that will check the other stand for damage.
SUBUNIT: Forms a heterotetramer with uvrA during the search for lesions. Interacts with uvrC in an incision complex.
SUBCELLULAR LOCATION: Cytoplasm.
DOMAIN: The beta-hairpin motif is involved in DNA binding.
MISCELLANEOUS: According to PubMed:3515321, a cleaved form of the protein was observed that resulted from the removal of about 40 amino acids from the C-terminus of the protein. The exact cleavage site being unknown, it was proposed to be between Lys-630 and Ala- 631. There was no indication that cleavage occured in vivo and therefore it is not known if it has any physiological significance.
SIMILARITY: Belongs to the uvrB family.
SIMILARITY: Contains 1 helicase ATP-binding domain.
SIMILARITY: Contains 1 helicase C-terminal domain.
SIMILARITY: Contains 1 UVR domain.
| NCBI GenPept GI number(s): |
67474768
|
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A8F8 |
P0A8F8 |
| PFAM: |
PF00271 PF04851 PF02151 |
PF00271 PF04851 PF02151 |
| InterPro: |
IPR014001 IPR001650 IPR014021 IPR006935 IPR001943 IPR004807 IPR009055 |
IPR014001 IPR001650 IPR014021 IPR006935 IPR001943 IPR004807 IPR009055 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSKPFKLNSAFKPSGDQPEAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIA NVIADLQRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEA YVPSSDTFIEKDASVNEHIEQMRLSATKAMLERRDVVVVASVSAIYGLGD PDLYLKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRVRGEVI DIFPAESDDIALRVELFDEEVERLSLFDPLTGQIVSTIPRFTIYPKTHYV TPRERIVQAMEEIKEELAARRKVLLENNKLLEEQRLTQRTQFDLEMMNEL GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGM YRGDRARKETLVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYE LEKSGGDVVDQVVRPTGLLDPIIEVRPVATQVDDLLSEIRQRAAINERVL VTTLTKRMAEDLTEYLEEHGERVRYLHSDIDTVERMEIIRDLRLGEFDVL VGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIGRAARNVNGKA ILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALG QNIAKTKAKGRGKSRPIVEPDNVPMDMSPKALQQKIHELEGLMMQHAQNL EFEEAAQIRDQLHQLRELFIAAS |
References:
| Title | Authors | Journal |
| Sequences of the E. coli uvrB gene and protein. | Arikan E, Kulkarni MS, Thomas DC, Sancar A. | Nucleic Acids Res. March 25, 1986 |
| Structure of the uvrB gene of Escherichia coli. Homology with other DNA repair enzymes and characterization of the uvrB5 mutation. | Backendorf C, Spaink H, Barbeiro AP, van de Putte P | Nucleic Acids Res April 11, 1986 |
| A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. | Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. | DNA Res June 1, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| NMR assignments and secondary structure of the UvrC binding domain of UvrB. | Alexandrovich A, Sanderson MR, Moolenaar GF, Goosen N, Lane AN | FEBS Lett May 21, 1999 |
| Crystal structure of Escherichia coli UvrB C-terminal domain, and a model for UvrB-uvrC interaction. | Sohi M, Alexandrovich A, Moolenaar G, Visse R, Goosen N, Vernede X, Fontecilla-Camps JC, Champness J, Sanderson MR | FEBS Lett Feb. 14, 2000 |
| Clue to damage recognition by UvrB: residues in the beta-hairpin structure prevent binding to non-damaged DNA. | Moolenaar GF, Hoglund L, Goosen N | EMBO J Nov. 1, 2001 |
| The presence of two UvrB subunits in the UvrAB complex ensures damage detection in both DNA strands. | Verhoeven EE, Wyman C, Moolenaar GF, Goosen N | EMBO J Aug. 1, 2002 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|