Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mug |
Protein FULL name:
G/U mismatch-specific DNA glycosylase [Escherichia coli str. K-12 substr. MG1655].
Mug (Escherichia coli strain K-12 substr. MG1655) is product of expression of mug gene.
Mug is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Excises ethenocytosine and uracil, which can arise by alkylation or deamination of cytosine, respectively, from the corresponding mispairs with guanine in ds-DNA. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and the mispaired base. The complementary strand guanine functions in substrate recognition. Required for DNA damage lesion repair in stationary-phase cells.
CATALYTIC ACTIVITY: Specifically hydrolyzes mismatched double- stranded DNA and polynucleotides, releasing free uracil.
ENZYME REGULATION: Subject to strong product inhibition. N- glycosyl hydrolysis proceeds 100-fold faster than product release.
SUBUNIT: Binds DNA as a monomer.
SUBCELLULAR LOCATION: Cytoplasm (Potential).
INDUCTION: Induced in stationary phase.
SIMILARITY: Belongs to the TDG/mug DNA glycosylase family.
| NCBI GenPept GI number(s): |
1789449 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A9H1 |
P0A9H1 |
| PFAM: | - |
P0A9H1 (Link - using uniprot id) |
| InterPro: | - |
P0A9H1 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQ LKPQEAQHLLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQ PQALAILGKQAYEQGFSQRGAQWGKQTLTIGSTQIWVLPNPSGLSRVSLE KLVEAYRELDQALVVRGR |
Mug (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
| Title | Authors | Journal |
| The nucleotide sequence of the cloned rpoD gene for the RNA polymerase sigma subunit from E coli K12. | Burton Z, Burgess RR, Lin J, Moore D, Holder S, Gross CA | Nucleic Acids Res June 25, 1981 |
| Detection of new genes in a bacterial genome using Markov models for three gene classes. | Borodovsky M, McIninch JD, Koonin EV, Rudd KE, Medigue C, Danchin A | Nucleic Acids Res Sept. 11, 1995 |
| A new class of uracil-DNA glycosylases related to human thymine-DNA glycosylase. | Gallinari P, Jiricny J | Nature Oct. 24, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Crystal structure of a G:T/U mismatch-specific DNA glycosylase: mismatch recognition by complementary-strand interactions. | Barrett TE, Savva R, Panayotou G, Barlow T, Brown T, Jiricny J, Pearl LH | Cell Feb. 9, 1998 |
| Structure of a DNA base-excision product resembling a cisplatin inter-strand adduct. | Barrett TE, Savva R, Barlow T, Brown T, Jiricny J, Pearl LH | Nat Struct Biol Aug. 1, 1998 |
| Crystal structure of a thwarted mismatch glycosylase DNA repair complex. | Barrett TE, Scharer OD, Savva R, Brown T, Jiricny J, Verdine GL, Pearl LH | EMBO J Dec. 1, 1999 |
| Escherichia coli DNA glycosylase Mug: a growth-regulated enzyme required for mutation avoidance in stationary-phase cells. | Mokkapati SK, Fernandez de Henestrosa AR, Bhagwat AS | Mol Microbiol Sept. 1, 2001 |
| Mismatch uracil glycosylase from Escherichia coli: a general mismatch or a specific DNA glycosylase? | O'Neill RJ, Vorob'eva OV, Shahbakhti H, Zmuda E, Bhagwat AS, Baldwin GS | J Biol Chem June 6, 2003 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|