Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
MutY |
Protein FULL name:
adenine DNA glycosylase [Escherichia coli str. K-12 substr. MG1655].
MutY (Escherichia coli strain K-12 substr. MG1655) is product of expression of mutY gene.
MutY is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Adenine glycosylase active on G-A mispairs. MutY also corrects error-prone DNA synthesis past GO lesions which are due to the oxidatively damaged form of guanine: 7,8-dihydro-8- oxoguanine (8-oxo-dGTP).
COFACTOR: Binds 1 4Fe-4S cluster. The cluster is not important for the catalytic activity, but which is probably involved in the proper positioning of the enzyme along the DNA strand.
SIMILARITY: Belongs to the nth/mutY family.
| NCBI GenPept GI number(s): |
16130862 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P17802 |
P17802 |
| PFAM: | - |
P17802 (Link - using uniprot id) |
| InterPro: | - |
P17802 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIP YFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLH GGKFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYA VSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMICTRSKPKCS LCPLQNGCIAAANNSWALYPGKKPKQTLPERTGYFLLLQHEDEVLLAQRP PSGLWGGLYCFPQFADEESLRQWLAQRQIAADNLTQLTAFRHTFSHFHLD IVPMWLPVSSFTGCMDEGNALWYNLAQPPSVGLAAPVERLLQQLRTGAPV |
MutY (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
| Title | Authors | Journal |
| MutY, an adenine glycosylase active on G-A mispairs, has homology to endonuclease III. | Michaels ML, Pham L, Nghiem Y, Cruz C, Miller JH | Nucleic Acids Res July 11, 1990 |
| Nucleotide sequence of the Escherichia coli micA gene required for A/G-specific mismatch repair: identity of micA and mutY. | Tsai-Wu JJ, Radicella JP, Lu AL | J Bacteriol March 1, 1991 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| MutY catalytic core, mutant and bound adenine structures define specificity for DNA repair enzyme superfamily. | Guan Y, Manuel RC, Arvai AS, Parikh SS, Mol CD, Miller JH, Lloyd S, Tainer JA | Nat Struct Biol Dec. 1, 1998 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|