|
|
Nej1p (Saccharomyces cerevisiae) is product of expression of
NEJ1
gene.
Nej1p is involved in:
NHEJ in Saccharomyces cerevisiae
FUNCTION: Involved in non-homologous end joining (NHEJ).
Facilitates the transport of LIF1 into the nucleus, where it can
interact with DNA ligase DNL4 to repair double-strand breaks
(DSB). Mediates mating-type regulation of NHEJ. Prevents
chromosome circularisation by NHEJ in absence of telomerase.
INTERACTION:
P53150:LIF1; NbExp=2; IntAct=EBI-34047, EBI-23865;
SUBCELLULAR LOCATION: Cytoplasm. Nucleus membrane; Multi-pass
membrane protein.
INDUCTION: Repressed in diploid cells.
MISCELLANEOUS: Present with 377 molecules/cell in log phase SD
medium.
SIMILARITY: Belongs to the XLF family.
Links to other databases:
Protein sequence:
MDSELKGQQLSDAEWCVKKINGEGNCLLLFLPMSSPTTIVMIVLVSLERL
VPYVFKLSQTQLSQQCQSQGFTDSISLNLIKLKLMDILQAPQEINQIGLV
DSNLVFSFDVSADITVSINSVPSHVTKDMFYMILQSLCMLLLKLVNLSTQ
YHYVQRDILNEKQKCLDFLLISLRDLDGGSKVISQWAPENSKNYESLQQC
TDDDIIKKLLHKGKFQHQEFLADSLKTLLSLRNKFQDVSRFEESGELNKK
ERVRFPAVNHFYNDDFELQADPTNEARPNSRGKIKPKTDFKPKSRESSTS
SQLRLENFSESEATPEKTKSSSSLVEEYPQKKRKFGKVRIKN
|
References:
|
Title
|
Authors
|
Journal
|
|
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.
|
Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al.
|
Nature
May 1, 1997
|
|
Nej1p, a cell type-specific regulator of nonhomologous end joining in yeast.
|
Kegel A, Sjostrand JO, Astrom SU
|
Curr Biol
Oct. 16, 2001
|
|
NHEJ regulation by mating type is exercised through a novel protein, Lif2p, essential to the ligase IV pathway.
|
Frank-Vaillant M, Marcand S
|
Genes Dev
Nov. 15, 2001
|
|
NEJ1 controls non-homologous end joining in Saccharomyces cerevisiae.
|
Valencia M, Bentele M, Vaze MB, Herrmann G, Kraus E, Lee SE, Schar P, Haber JE
|
Nature
Dec. 6, 2001
|
|
A DNA microarray-based genetic screen for nonhomologous end-joining mutants in Saccharomyces cerevisiae.
|
Ooi SL, Shoemaker DD, Boeke JD
|
Science
Dec. 21, 2001
|
|
A genomics-based screen for yeast mutants with an altered recombination/end-joining repair ratio.
|
Wilson TE
|
Genetics
Oct. 1, 2002
|
|
NEJ1 prevents NHEJ-dependent telomere fusions in yeast without telomerase.
|
Liti G, Louis EJ
|
Mol Cell
May 1, 2003
|
|
Global analysis of protein expression in yeast.
|
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
|
Nature
Oct. 16, 2003
|
|
Global analysis of protein localization in budding yeast.
|
Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK
|
Nature
Oct. 16, 2003
|
|
Mutations of the Yku80 C terminus and Xrs2 FHA domain specifically block yeast nonhomologous end joining.
|
Palmbos PL, Daley JM, Wilson TE
|
Mol Cell Biol
Dec. 1, 2005
|
|
Sequence diversity, reproductive isolation and species concepts in Saccharomyces.
|
Liti G, Barton DB, Louis EJ
|
Genetics
Oct. 1, 2006
|
|
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.
|
Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J
|
Genome Res
April 1, 2007
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|