Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Nej1p |
Nej1p is involved in:
NHEJ in Saccharomyces cerevisiae
FUNCTION: Involved in non-homologous end joining (NHEJ). Facilitates the transport of LIF1 into the nucleus, where it can interact with DNA ligase DNL4 to repair double-strand breaks (DSB). Mediates mating-type regulation of NHEJ. Prevents chromosome circularisation by NHEJ in absence of telomerase.
INTERACTION: P53150:LIF1; NbExp=2; IntAct=EBI-34047, EBI-23865;
SUBCELLULAR LOCATION: Cytoplasm. Nucleus membrane; Multi-pass membrane protein.
INDUCTION: Repressed in diploid cells.
MISCELLANEOUS: Present with 377 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the XLF family.
| NCBI GenPept GI number(s): |
296146799 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q06148 |
Q06148 |
| PFAM: | - |
Q06148 (Link - using uniprot id) |
| InterPro: | - |
Q06148 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDSELKGQQLSDAEWCVKKINGEGNCLLLFLPMSSPTTIVMIVLVSLERL VPYVFKLSQTQLSQQCQSQGFTDSISLNLIKLKLMDILQAPQEINQIGLV DSNLVFSFDVSADITVSINSVPSHVTKDMFYMILQSLCMLLLKLVNLSTQ YHYVQRDILNEKQKCLDFLLISLRDLDGGSKVISQWAPENSKNYESLQQC TDDDIIKKLLHKGKFQHQEFLADSLKTLLSLRNKFQDVSRFEESGELNKK ERVRFPAVNHFYNDDFELQADPTNEARPNSRGKIKPKTDFKPKSRESSTS SQLRLENFSESEATPEKTKSSSSLVEEYPQKKRKFGKVRIKN |
References:
| Title | Authors | Journal |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XII. | Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H, Dubois E, Dusterhoft A, Entian KD, Floeth M, Goffeau A, Hebling U, Heumann K, Heuss-Neitzel D, Hilbert H, Hilger F, Kleine K, Kotter P, Louis EJ, Messenguy F, Mewes HW, Hoheisel JD, et al. | Nature May 1, 1997 |
| Nej1p, a cell type-specific regulator of nonhomologous end joining in yeast. | Kegel A, Sjostrand JO, Astrom SU | Curr Biol Oct. 16, 2001 |
| NHEJ regulation by mating type is exercised through a novel protein, Lif2p, essential to the ligase IV pathway. | Frank-Vaillant M, Marcand S | Genes Dev Nov. 15, 2001 |
| NEJ1 controls non-homologous end joining in Saccharomyces cerevisiae. | Valencia M, Bentele M, Vaze MB, Herrmann G, Kraus E, Lee SE, Schar P, Haber JE | Nature Dec. 6, 2001 |
| A DNA microarray-based genetic screen for nonhomologous end-joining mutants in Saccharomyces cerevisiae. | Ooi SL, Shoemaker DD, Boeke JD | Science Dec. 21, 2001 |
| A genomics-based screen for yeast mutants with an altered recombination/end-joining repair ratio. | Wilson TE | Genetics Oct. 1, 2002 |
| NEJ1 prevents NHEJ-dependent telomere fusions in yeast without telomerase. | Liti G, Louis EJ | Mol Cell May 1, 2003 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Global analysis of protein localization in budding yeast. | Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK | Nature Oct. 16, 2003 |
| Mutations of the Yku80 C terminus and Xrs2 FHA domain specifically block yeast nonhomologous end joining. | Palmbos PL, Daley JM, Wilson TE | Mol Cell Biol Dec. 1, 2005 |
| Sequence diversity, reproductive isolation and species concepts in Saccharomyces. | Liti G, Barton DB, Louis EJ | Genetics Oct. 1, 2006 |
| Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. | Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J | Genome Res April 1, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|