|
|
Protein FULL name: Protein that recognizes and binds damaged DNA during nucleotide excision repair; subunit of Nucleotide Excision Repair Factor 1 (NEF1); contains zinc finger motif; homolog of human XPA protein
Rad14p (Saccharomyces cerevisiae) is product of expression of
RAD14
gene.
Rad14p is involved in:
NER in Saccharomyces cerevisiae
FUNCTION: Involved in nucleotide excision repair. Binds
specifically to damaged DNA. Required for the incision step.
SUBUNIT: Component of the nucleotide excision repair factor 1
(NEF1) complex consisting of RAD1, RAD10 and RAD14.
INTERACTION:
P06777:RAD1; NbExp=1; IntAct=EBI-14641, EBI-14752;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 1030 molecules/cell in log phase SD
medium.
SIMILARITY: Belongs to the XPA family.
Links to other databases:
Protein sequence:
MTPEQKAKLEANRKLAIERLRKRGILSSDQLNRIESRNEPLKTRPLAVTS
GSNRDDNAAAAVHVPNHNGQPSALANTNTNTTSLYGSGVVDGSKRDASVL
DKRPTDRIRPSIRKQDYIEYDFATMQNLNGGYINPKDKLPNSDFTDDQEF
ESEFGSKKQKTLQDWKKEQLERKMLYENAPPPEHISKAPKCIECHINIEM
DPVLHDVFKLQVCKQCSKEHPEKYALLTKTECKEDYFLTDPELNDEDLFH
RLEKPNPHSGTFARMQLFVRCEVEAFAFKKWGGEEGLDEEWQRREEGKAH
RREKKYEKKIKEMRLKTRAQEYTNRLREKKHGKAHIHHFSDPVDGGIDED
GYQIQRRRCTDCGLETEEIDI
|
References:
|
Title
|
Authors
|
Journal
|
|
Yeast RAD14 and human xeroderma pigmentosum group A DNA-repair genes encode homologous proteins.
|
Bankmann M, Prakash L, Prakash S
|
Nature
Jan. 6, 1992
|
|
Yeast DNA-repair gene RAD14 encodes a zinc metalloprotein with affinity for ultraviolet-damaged DNA.
|
Guzder SN, Sung P, Prakash L, Prakash S
|
Proc Natl Acad Sci U S A
June 15, 1993
|
|
Nucleotide excision repair in yeast is mediated by sequential assembly of repair factors and not by a pre-assembled repairosome.
|
Guzder SN, Sung P, Prakash L, Prakash S
|
J Biol Chem
April 12, 1996
|
|
Characterization of the rad14-2 mutant of Saccharomyces cerevisiae: implications for the recognition of UV photoproducts by the Rad14 protein.
|
Jones GW, Reed SH, Waters R
|
Yeast
Feb. 1, 1997
|
|
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII.
|
Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B
|
Nature
May 1, 1997
|
|
Global analysis of protein expression in yeast.
|
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
|
Nature
Oct. 16, 2003
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|