|
|
Protein FULL name: DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase III subunit L, RPB10 homolog, RNA polymerase II 7.6 kDa subunit,
Protein SHORT name: RNA polymerases I, II, and III subunit ABC5 RPB7.6.
POLR2L (Homo sapiens) is product of expression of
POLR2L
gene.
FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription
of DNA into RNA using the four ribonucleoside triphosphates as
substrates. Common component of RNA polymerases I, II and III
which synthesize ribosomal RNA precursors, mRNA precursors and
many functional non-coding RNAs, and a small RNAs, such as 5S rRNA
and tRNAs, respectively. Pol II is the central component of the
basal RNA polymerase II transcription machinery. Pols are composed
of mobile elements that move relative to each other. In Pol II,
POLR2L/RBP10 is part of the core element with the central large
cleft (By similarity).
SUBUNIT: Component of the RNA polymerase I (Pol I), RNA polymerase
II (Pol II) and RNA polymerase III (Pol III) complexes consisting
of at least 13, 12 and 17 subunits, respectively (By similarity).
SUBCELLULAR LOCATION: Nucleus.
SIMILARITY: Belongs to the archaeal rpoN/eukaryotic RPB10 RNA
polymerase subunit family.
Links to other databases:
Protein sequence:
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLL
AHVDLIEKLLNYAPLEK
|
POLR2L (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Four subunits that are shared by the three classes of RNA polymerase are functionally interchangeable between Homo sapiens and Saccharomyces cerevisiae.
|
Shpakovski GV, Acker J, Wintzerith M, Lacroix JF, Thuriaux P, Vigneron M
|
Mol Cell Biol
Sept. 1, 1995
|
|
Six human RNA polymerase subunits functionally substitute for their yeast counterparts.
|
McKune K, Moore PA, Hull MW, Woychik NA
|
Mol Cell Biol
Dec. 1, 1995
|
|
Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
|
Kershnar E, Wu SY, Chiang CM
|
J Biol Chem
Dec. 18, 1998
|
|
Complete sequencing and characterization of 21,243 full-length human cDNAs.
|
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S
|
Nat Genet
Feb. 1, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
RNA polymerase I-specific subunit CAST/hPAF49 has a role in the activation of transcription by upstream binding factor.
|
Panov KI, Panova TB, Gadal O, Nishiyama K, Saito T, Russell J, Zomerdijk JC
|
Mol Cell Biol
July 1, 2006
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|