|
|
Protein FULL name: SOS cell division inhibitor [Escherichia coli str. K-12 substr. W3110].
SulA (Escherichia coli strain K-12 substr. MG1655) is product of expression of
sulA
gene.
SulA is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Component of the SOS system and an inhibitor of cell
division. Accumulation of sulA causes rapid cessation of cell
division and the appearance of long, non-septate filaments. In the
presence of GTP, binds a polymerization-competent form of ftsZ in
a 1:1 ratio, thus inhibiting ftsZ polymerization and therefore
preventing it from participating in the assembly of the Z ring.
This mechanism prevents the premature segregation of damaged DNA
to daughter cells during cell division.
SUBUNIT: Interacts with ftsZ.
INDUCTION: By DNA damage, as part of the SOS response. Repressed
by lexA.
PTM: Is rapidly cleaved and degraded by the lon protease once DNA
damage is repaired.
SIMILARITY: Belongs to the sulA family.
SEQUENCE CAUTION:
Sequence=CAA23587.1; Type=Frameshift; Positions=145;
Links to other databases:
Protein sequence:
MYTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLL
LPLLQQLGQQSRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTV
ESMVRALRTGNYSVVIGWLADDLTEEEHAELVDAANEGNAMGFIMRPVSA
SSHATRQLSGLKIHSNLYH
|
References:
|
Title
|
Authors
|
Journal
|
|
Nucleotide sequence of the gene ompA coding the outer membrane protein II of Escherichia coli K-12.
|
Beck E, Bremer E
|
Nucleic Acids Res
July 11, 1980
|
|
Characterisation of the promoter for the LexA regulated sulA gene of Escherichia coli.
|
Cole ST
|
Mol Gen Genet
Jan. 1, 1983
|
|
Protein degradation in Escherichia coli: the lon gene controls the stability of sulA protein.
|
Mizusawa S, Gottesman S
|
Proc Natl Acad Sci U S A
Feb. 1, 1983
|
|
Cell-division control in Escherichia coli: specific induction of the SOS function SfiA protein is sufficient to block septation.
|
Huisman O, D'Ari R, Gottesman S
|
Proc Natl Acad Sci U S A
July 1, 1984
|
|
Role of the SulB (FtsZ) protein in division inhibition during the SOS response in Escherichia coli: FtsZ stabilizes the inhibitor SulA in maxicells.
|
Jones C, Holland IB
|
Proc Natl Acad Sci U S A
Sept. 1, 1985
|
|
Evolution of the enterobacterial sulA gene: a component of the SOS system encoding an inhibitor of cell division.
|
Freudl R, Braun G, Honore N, Cole ST
|
Gene
Jan. 1, 1987
|
|
Analysis of ftsZ mutations that confer resistance to the cell division inhibitor SulA (SfiA).
|
Bi E, Lutkenhaus J
|
J Bacteriol
Oct. 1, 1990
|
|
Cell division inhibitors SulA and MinCD prevent formation of the FtsZ ring.
|
Bi E, Lutkenhaus J
|
J Bacteriol
Jan. 1, 1993
|
|
A cell division inhibitor SulA of Escherichia coli directly interacts with FtsZ through GTP hydrolysis.
|
Higashitani A, Higashitani N, Horiuchi K
|
Biochem Biophys Res Commun
April 6, 1995
|
|
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map.
|
Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.
|
DNA Res
June 1, 1996
|
|
Interaction between FtsZ and inhibitors of cell division.
|
Huang J, Cao C, Lutkenhaus J
|
J Bacteriol
Sept. 1, 1996
|
|
Functional dissection of a cell-division inhibitor, SulA, of Escherichia coli and its negative regulation by Lon.
|
Higashitani A, Ishii Y, Kato Y, Koriuchi K
|
Mol Gen Genet
April 28, 1997
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
Inhibition of FtsZ polymerization by SulA, an inhibitor of septation in Escherichia coli.
|
Mukherjee A, Cao C, Lutkenhaus J
|
Proc Natl Acad Sci U S A
March 17, 1998
|
|
Bacterial SOS checkpoint protein SulA inhibits polymerization of purified FtsZ cell division protein.
|
Trusca D, Scott S, Thompson C, Bramhill D
|
J Bacteriol
Aug. 1, 1998
|
|
Regulatory role of C-terminal residues of SulA in its degradation by Lon protease in Escherichia coli.
|
Ishii Y, Sonezaki S, Iwasaki Y, Miyata Y, Akita K, Kato Y, Amano F
|
J Biochem
May 1, 2000
|
|
Cell division inhibitors SulA and MinC/MinD block septum formation at different steps in the assembly of the Escherichia coli division machinery.
|
Justice SS, Garcia-Lara J, Rothfield LI
|
Mol Microbiol
July 1, 2000
|
|
Regulation of SulA cleavage by Lon protease by the C-terminal amino acid of SulA, histidine.
|
Ishii Y, Amano F
|
Biochem J
Sept. 1, 2001
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
|
Investigation of regulation of FtsZ assembly by SulA and development of a model for FtsZ polymerization.
|
Dajkovic A, Mukherjee A, Lutkenhaus J
|
J Bacteriol
April 1, 2008
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|