Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
MBD4 |
Protein FULL name:
Methyl-CpG-binding domain protein 4, Methyl-CpG-binding protein MBD4, Methyl-CpG-binding endonuclease 1, Mismatch-specific DNA N-glycosylase.,
MBD4 (Homo sapiens) is product of expression of MBD4 gene.
MBD4 is involved in:
BER in Homo sapiens
Keywords:
FUNCTION: Mismatch-specific DNA N-glycosylase involved in DNA repair. Has thymine glycosylase activity and is specific for G:T mismatches within methylated and unmethylated CpG sites. Can also remove uracil or 5-fluorouracil in G:U mismatches. Has no lyase activity. Was first identified as methyl-CpG-binding protein.
SUBUNIT: Interacts with MLH1.
INTERACTION: P67870:CSNK2B; NbExp=1; IntAct=EBI-348011, EBI-348169; Q13158:FADD; NbExp=5; IntAct=EBI-348011, EBI-494804;
SUBCELLULAR LOCATION: Nucleus.
SIMILARITY: Contains 1 MBD (methyl-CpG-binding) domain.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
50400819 4505121 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | O95243 |
O95243 |
| PFAM: |
PF00730 PF01429 |
PF00730 PF01429 |
| InterPro: |
IPR016177 IPR011257 IPR003265 IPR017352 IPR001739 |
IPR016177 IPR011257 IPR003265 IPR017352 IPR001739 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDE EQMMIKRSSECNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFG KTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPEDFDFTVLSKRG IKSRYKDCSMAALTSHLQNQSNNSNWNLRTRSKCKKDVFMPPSSSSELQE SRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGC RKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETL SVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYED TFLESEEIGTKVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQ EDTIPRTQIERRKTSLYFSSKYNKEALSPPRRKAFKKWTPPRSPFNLVQE TLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVS ELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCV NEWKQVHPEDHKLNKYHDWLWENHEKLSLS |
MBD4 (Homo sapiens) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Identification and characterization of a family of mammalian methyl-CpG binding proteins. | Hendrich B, Bird A | Mol Cell Biol Nov. 1, 1998 |
| MED1, a novel human methyl-CpG-binding endonuclease, interacts with DNA mismatch repair protein MLH1. | Bellacosa A, Cicchillitti L, Schepis F, Riccio A, Yeung AT, Matsumoto Y, Golemis EA, Genuardi M, Neri G | Proc Natl Acad Sci U S A March 1, 1999 |
| Genomic structure and chromosomal mapping of the murine and human Mbd1, Mbd2, Mbd3, and Mbd4 genes. | Hendrich B, Abbott C, McQueen H, Chambers D, Cross S, Bird A | Mamm Genome Sept. 1, 1999 |
| Biphasic kinetics of the human DNA repair protein MED1 (MBD4), a mismatch-specific DNA N-glycosylase. | Petronzelli F, Riccio A, Markham GD, Seeholzer SH, Stoerker J, Genuardi M, Yeung AT, Matsumoto Y, Bellacosa A | J Biol Chem Oct. 20, 2000 |
| Fas-associated death domain protein interacts with methyl-CpG binding domain protein 4: a potential link between genome surveillance and apoptosis. | Screaton RA, Kiessling S, Sansom OJ, Millar CB, Maddison K, Bird A, Clarke AR, Frisch SM | Proc Natl Acad Sci U S A April 1, 2003 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|