|
|
Protein FULL name: UV excision repair protein RAD23 homolog B [Homo sapiens].
RAD23B (Homo sapiens) is product of expression of
RAD23B
gene.
RAD23B is involved in:
NER in Homo sapiens
FUNCTION: Plays a central role both in proteosomal degradation of
misfolded proteins and DNA repair. Central component of a complex
required to couple deglycosylation and proteasome-mediated
degradation of misfolded proteins in the endoplasmic reticulun
that are retrotranslocated in the cytosol. Involved in DNA
excision repair by stabilizing XPC protein. May play a part in DNA
damage recognition and/or in altering chromatin structure to allow
access by damage-processing enzymes.
SUBUNIT: Component of a complex required to couple
retrotranslocation, ubiquitination and deglycosylation composed of
NGLY1, SAKS1, AMFR, VCP and RAD23B (By similarity). Interacts with
the 26S proteasome. Interacts directly with NGLY1. Heterodimer of
a 125 kDa subunit (p125) and of a 58 kDa subunit (p58). Interacts
with MJD and XPC.
INTERACTION:
P24610:Pax3 (xeno); NbExp=1; IntAct=EBI-954531, EBI-1208116;
SUBCELLULAR LOCATION: Nucleus. Cytoplasm (By similarity).
DOMAIN: The ubiquitin-like domain mediates interaction with MJD.
SIMILARITY: Belongs to the RAD23 family.
SIMILARITY: Contains 1 STI1 domain.
SIMILARITY: Contains 2 UBA domains.
SIMILARITY: Contains 1 ubiquitin-like domain.
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
Links to other databases:
Protein sequence:
MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAG
KILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVT
SSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAE
KPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSM
GYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAP
QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIA
EAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANF
LLQQNFDED
|
RAD23B (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Purification and cloning of a nucleotide excision repair complex involving the xeroderma pigmentosum group C protein and a human homologue of yeast RAD23.
|
Masutani C, Sugasawa K, Yanagisawa J, Sonoyama T, Ui M, Enomoto T, Takio K, Tanaka K, van der Spek PJ, Bootsma D, et al.
|
EMBO J
April 15, 1994
|
|
Binding surface mapping of intra- and interdomain interactions among hHR23B, ubiquitin, and polyubiquitin binding site 2 of S5a.
|
Ryu KS, Lee KJ, Bae SH, Kim BK, Kim KA, Choi BS
|
J Biol Chem
Sept. 19, 2003
|
|
Structure of the ubiquitin-interacting motif of S5a bound to the ubiquitin-like domain of HR23B.
|
Fujiwara K, Tenno T, Sugasawa K, Jee JG, Ohki I, Kojima C, Tochio H, Hiroaki H, Hanaoka F, Shirakawa M
|
J Biol Chem
Jan. 6, 2004
|
|
Complete sequencing and characterization of 21,243 full-length human cDNAs.
|
Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S
|
Nat Genet
Feb. 1, 2004
|
|
DNA sequence and analysis of human chromosome 9.
|
Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I
|
Nature
May 27, 2004
|
|
A complex between peptide:N-glycanase and two proteasome-linked proteins suggests a mechanism for the degradation of misfolded glycoproteins.
|
Katiyar S, Li G, Lennarz WJ
|
Proc Natl Acad Sci U S A
Sept. 21, 2004
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
Solution structure and backbone dynamics of the XPC-binding domain of the human DNA repair protein hHR23B.
|
Kim B, Ryu KS, Kim HJ, Cho SJ, Choi BS
|
FEBS J
May 1, 2005
|
|
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
|
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
|
Cell
Nov. 3, 2006
|
|
Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.
|
Molina H, Horn DM, Tang N, Mathivanan S, Pandey A
|
Proc Natl Acad Sci U S A
Jan. 13, 2007
|
|
Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
|
Wang X, Chen CF, Baker PR, Chen PL, Kaiser P, Huang L
|
Biochemistry
March 20, 2007
|
|
Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
|
Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD
|
J Proteome Res
Nov. 1, 2007
|
|
A quantitative atlas of mitotic phosphorylation.
|
Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP
|
Proc Natl Acad Sci U S A
Aug. 5, 2008
|
|
Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
|
Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M
|
Mol Cell
Aug. 8, 2008
|
|
Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
|
Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK
|
Sci Signal
Jan. 1, 2009
|
|
Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
|
Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S
|
Anal Chem
June 1, 2009
|
|
Lysine acetylation targets protein complexes and co-regulates major cellular functions.
|
Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M
|
Science
Aug. 14, 2009
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|