Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Rpa1p |
Rpa1p is involved in:
MMR in Saccharomyces cerevisiae
- RPA protects single stranded DNA (5' directed) in Saccharomyces cerevisiae
- ExoI excises erroneous strand some distance beyond the mismatch (5' directed) in Saccharomyces cerevisiae
- DNA polymerase delta resynthesizes DNA (5' directed MMR) in Saccharomyces cerevisiae
- RPA protects single stranded DNA (5' directed, proximal site) in Saccharomyces cerevisiae
- ExoI excises erroneous strand some distance beyond the mismatch (5' directed, proximal site) in Saccharomyces cerevisiae
- DNA polymerase 3 resynthesizes DNA (5' directed MMR, proximal site) in Saccharomyces cerevisiae
- RPA protects single stranded DNA (3' directed) in Saccharomyces cerevisiae
- ExoI excises erroneous strand some distance beyond the mismatch (3' directed) in Saccharomyces cerevisiae
- DNA polymerase 3 resynthesizes DNA (3' directed MMR) in Saccharomyces cerevisiae
- Polymerase Delta rebuilds missing fragment in Saccharomyces cerevisiae
- Polymerase Epsilon rebuilds missing fragment in Saccharomyces cerevisiae
- Homologous strands pairing in Saccharomyces cerevisiae
- Rad51 binds to ssDNA in Saccharomyces cerevisiae
- Strand exchange in Saccharomyces cerevisiae
- RPA binds to undamaged strand in Saccharomyces cerevisiae
- Rad2 joins the complex in Saccharomyces cerevisiae
- recruitment of Rad1/Rad10 complex in Saccharomyces cerevisiae
- RNAP dissociates in Saccharomyces cerevisiae
- ubiquitination of Rad26 in Saccharomyces cerevisiae
- Removal of the damaged strand fragment in Saccharomyces cerevisiae
- Polymerase 3 fills the gap in Saccharomyces cerevisiae
- DPB3 fills the gap in Saccharomyces cerevisiae
- removal of fragment of damaged strand in Saccharomyces cerevisiae
- Rad14 recruits Rad1/Rad10 complex in Saccharomyces cerevisiae
- XPC complex dissotiates in Saccharomyces cerevisiae
FUNCTION: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase I which synthesizes ribosomal RNA precursors. Forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol I. A bridging helix emanates from RPA1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol I by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition (By similarity).
CATALYTIC ACTIVITY: Nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1).
SUBUNIT: Component of the RNA polymerase I (Pol I) complex consisting of 14 subunits.
INTERACTION: P28007:GAR1; NbExp=1; IntAct=EBI-15730, EBI-7321; P22138:RPA2; NbExp=1; IntAct=EBI-15730, EBI-15736; P07703:RPC40; NbExp=1; IntAct=EBI-15730, EBI-15831; P20435:RPO26; NbExp=1; IntAct=EBI-15730, EBI-15786;
SUBCELLULAR LOCATION: Nucleus, nucleolus.
MISCELLANEOUS: Present with 2840 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the RNA polymerase beta' chain family.
| NCBI GenPept GI number(s): |
88191850 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P10964 |
P10964 |
| PFAM: | - |
P10964 (Link - using uniprot id) |
| InterPro: | - |
P10964 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | 1YNX |
1YNX |
Protein sequence:
|
TRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTS GEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNL DRDTVIEECFDESN |
Rpa1p (Saccharomyces cerevisiae) is able to recognize following damages:
Solved crystal structures:
References:
| Title | Authors | Journal |
| RPA190, the gene coding for the largest subunit of yeast RNA polymerase A. | Memet S, Gouy M, Marck C, Sentenac A, Buhler JM | J Biol Chem Jan. 25, 1988 |
| Nucleotide sequence analysis of a 40 kb segment on the right arm of yeast chromosome XV reveals 18 open reading frames including a new pyruvate kinase and three homologues to chromosome I genes. | Purnelle B, Goffeau A | Yeast Nov. 1, 1996 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. | Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. | Nature May 1, 1997 |
| Differential roles of phosphorylation in the formation of transcriptional active RNA polymerase I. | Fath S, Milkereit P, Peyroche G, Riva M, Carles C, Tschochner H | Proc Natl Acad Sci U S A Dec. 4, 2001 |
| Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae. | Ficarro SB, McCleland ML, Stukenberg PT, Burke DJ, Ross MM, Shabanowitz J, Hunt DF, White FM | Nat Biotechnol March 1, 2002 |
| Rpa12p, a conserved RNA polymerase I subunit with two functional domains. | Van Mullem V, Landrieux E, Vandenhaute J, Thuriaux P | Mol Microbiol March 1, 2002 |
| Localization of the yeast RNA polymerase I-specific subunits. | Bischler N, Brino L, Carles C, Riva M, Tschochner H, Mallouh V, Schultz P | EMBO J Aug. 1, 2002 |
| The A14-A43 heterodimer subunit in yeast RNA pol I and their relationship to Rpb4-Rpb7 pol II subunits. | Peyroche G, Levillain E, Siaut M, Callebaut I, Schultz P, Sentenac A, Riva M, Carles C | Proc Natl Acad Sci U S A Nov. 12, 2002 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Global analysis of protein localization in budding yeast. | Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK | Nature Oct. 16, 2003 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|