Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Ada |
Protein FULL name:
Regulatory protein Ada, Regulatory protein of adaptative response, Contains: Methylated-DNA-protein-cysteine methyltransferase, O-6-methylguanine-DNA alkyltransferase.,
Ada (Escherichia coli strain K-12 substr. MG1655) is product of expression of ada gene.
Ada is involved in:
DRR in Escherichia coli strain K-12 substr. MG1655
- Ogt or Ada recognise damaged base in Escherichia coli strain K-12 substr. MG1655
- Ogt or Ada eliminate methyl group from damaged base in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Repair of alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. Can also repair O-4-methylthymine.
FUNCTION: The methylated ADA protein acts as a positive regulator of its own synthesis, as well as that of other proteins. The transcription-activating function of the ADA protein resides in its N-terminus. It activates the transcription of alkA, alkB and aidB.
CATALYTIC ACTIVITY: DNA (containing 6-O-methylguanine) + protein L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L- cysteine.
COFACTOR: Binds 1 zinc ion per subunit.
MISCELLANEOUS: This enzyme catalyzes only one turnover and therefore is not strictly catalytic. According to one definition, an enzyme is a biocytalyst that acts repeatedly and over many reaction cycles.
SIMILARITY: In the C-terminal section; belongs to the MGMT family.
SIMILARITY: Contains 1 HTH araC/xylS-type DNA-binding domain.
| NCBI GenPept GI number(s): |
461468 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P06134 |
P06134 |
| PFAM: |
PF02805 PF01035 PF00165 PF02870 |
PF02805 PF01035 PF00165 PF02870 |
| InterPro: |
IPR004026 IPR016221 IPR009057 IPR000005 IPR018062 IPR018060 IPR001497 IPR014048 IPR008332 IPR011991 |
IPR004026 IPR016221 IPR009057 IPR000005 IPR018062 IPR018060 IPR001497 IPR014048 IPR008332 IPR011991 |
| CATH: | None | |
| SCOP: | None | |
| PDB: | - | - |
Protein sequence:
|
MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRE NVSFYANASEALAAGFRPCKRCQPEKANAQQHRLDKITHACRLLEQETPV TLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRARRLRESLAKGESV TTSILNAGFPDSSSYYRKADETLGMTAKQFRHGGENLAVRYALADCELGR CLVAESERGICAILLGDDDATLISELQQMFPAADNAPADLMFQQHVREVI ASLNQRDTPLTLPLDIRGTAFQQQVWQALRTIPCGETVSYQQLANAIGKP KAVRAVASACAANKLAIIIPCHRVVRGDGTLSGYRWGVSRKAQLLRREAE NEER |
Ada (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
Last modification of this entry: Nov. 14, 2020.
Add your own comment!
There is no comment yet.
|
|
|
|