Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Ogt |
Protein FULL name:
6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase., Methylated-DNA-protein-cysteine methyltransferase,
Ogt (Escherichia coli strain K-12 substr. MG1655) is product of expression of ogt gene.
Ogt is involved in:
DRR in Escherichia coli strain K-12 substr. MG1655
- Ogt or Ada recognise damaged base in Escherichia coli strain K-12 substr. MG1655
- Ogt or Ada eliminate methyl group from damaged base in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. Can also repair O-4-methylthymine.
CATALYTIC ACTIVITY: DNA (containing 6-O-methylguanine) + protein L-cysteine = DNA (without 6-O-methylguanine) + protein S-methyl-L- cysteine.
MISCELLANEOUS: This enzyme catalyzes only one turnover and therefore is not strictly catalytic. According to one definition, an enzyme is a biocytalyst that acts repeatedly and over many reaction cycles.
SIMILARITY: Belongs to the MGMT family.
| NCBI GenPept GI number(s): |
84027827 16129296 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0AFH0 |
P0AFH0 |
| PFAM: |
PF01035 PF02870 |
PF01035 PF02870 |
| InterPro: |
IPR001497 IPR014048 IPR008332 IPR011991 |
IPR001497 IPR014048 IPR008332 IPR011991 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MLRLLEEKIATPLGPLWVICDEQFRLRAVEWEEYSERMVQLLDIHYRKEG YERISATNPGGLSDKLREYFAGNLSIIDTLPTATGGTPFQREVWKTLRTI PCGQVMHYGQLAEQLGRPGAARAVGAANGSNPISIVVPCHRVIGRNGTMT GYAGGVQRKEWLLRHEGYLLL |
Ogt (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Characterisation and nucleotide sequence of ogt, the O6-alkylguanine-DNA-alkyltransferase gene of E. coli. | Potter PM, Wilkinson MC, Fitton J, Carr FJ, Brennand J, Cooper DP, Margison GP | Nucleic Acids Res Nov. 25, 1987 |
| Site directed mutagenesis of two cysteine residues in the E. coli ogt O6-alkylguanine DNA alkyltransferase protein. | Harris LC, Potter PM, Margison GP | Biochem Biophys Res Commun Aug. 31, 1992 |
| A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. | Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Nov. 14, 2020.
Add your own comment!
There is no comment yet.
|
|
|
|