|
|
Protein FULL name: TFIIH basal transcription factor complex helicase XPB subunit, Basic transcription factor 2 89 kDa subunit, TFIIH basal transcription factor complex 89 kDa subunit, DNA repair protein complementing XP-B cells, Xeroderma pigmentosum group B-complementing protein, DNA excision repair protein ERCC-3.,
Protein SHORT name: XPB, XP-B, ERCC3, ERCC-3
XPB (Homo sapiens) is product of expression of
ERCC3
gene.
Human diseases related to this protein:
XPB is involved in:
NER in Homo sapiens
Keywords:
FUNCTION: ATP-dependent 3'-5' DNA helicase, component of the core-
TFIIH basal transcription factor, involved in nucleotide excision
repair (NER) of DNA and, when complexed to CAK, in RNA
transcription by RNA polymerase II. Acts by opening DNA either
around the RNA transcription start site or the DNA damage.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
SUBUNIT: One of the 6 subunits forming the core-TFIIH basal
transcription factor which associates with the CAK complex
composed of CDK7, CCNH/cyclin H and MNAT1 to form the TFIIH basal
transcription factor. Interacts with PUF60. Interacts with
Epstein-Barr virus EBNA2.
INTERACTION:
P62195:PSMC5; NbExp=1; IntAct=EBI-1183307, EBI-357745;
P62196:Psmc5 (xeno); NbExp=5; IntAct=EBI-1183307, EBI-357713;
SUBCELLULAR LOCATION: Nucleus.
DISEASE: Defects in ERCC3 are the cause of xeroderma pigmentosum
complementation group B (XP-B) [MIM:610651]; also known as
xeroderma pigmentosum II (XP2) or XP group B (XPB) or xeroderma
pigmentosum group B combined with Cockayne syndrome (XP-B/CS).
Xeroderma pigmentosum is an autosomal recessive pigmentary skin
disorder characterized by solar hypersensitivity of the skin, high
predisposition for developing cancers on areas exposed to sunlight
and, in some cases, neurological abnormalities. Some XP-B patients
present features of Cockayne syndrome, including dwarfism,
sensorineural deafness, microcephaly, mental retardation,
pigmentary retinopathy, ataxia, decreased nerve conduction
velocities.
DISEASE: Defects in ERCC3 are a cause of trichothiodystrophy
photosensitive (TTDP) [MIM:601675]. TTDP is an autosomal recessive
disease characterized by sulfur-deficient brittle hair and nails,
ichthyosis, mental retardation, impaired sexual development,
abnormal facies and cutaneous photosensitivity correlated with a
nucleotide excision repair (NER) defect. Neonates with
trichothiodystrophy and ichthyosis are usually born with a
collodion membrane. The severity of the ichthyosis after the
membrane is shed is variable, ranging from a mild to severe
lamellar ichthyotic phenotype. There are no reports of skin cancer
associated with TTDP.
SIMILARITY: Belongs to the helicase family. RAD25/XPB subfamily.
SIMILARITY: Contains 1 helicase ATP-binding domain.
SIMILARITY: Contains 1 helicase C-terminal domain.
WEB RESOURCE: Name=Allelic variations of the XP genes;
[LINK]
WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
[LINK]
WEB RESOURCE: Name=GeneReviews;
[LINK]
WEB RESOURCE: Name=NIEHS-SNPs;
[LINK]
This protein can be a part of a given complexes:
Links to other databases:
Protein sequence:
MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG
TKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFL
VAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPD
GIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLR
NSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFD
FYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND
SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVG
VTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKP
IGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKM
FRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNG
YIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKF
HERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP
KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGM
VAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEED
LAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSM
SGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK
|
XPB (Homo sapiens) belongs to following protein families:
References:
|
Title
|
Authors
|
Journal
|
|
Molecular cloning and biological characterization of the human excision repair gene ERCC-3.
|
Weeda G, van Ham RC, Masurel R, Westerveld A, Odijk H, de Wit J, Bootsma D, van der Eb AJ, Hoeijmakers JH
|
Mol Cell Biol
June 1, 1990
|
|
A presumed DNA helicase encoded by ERCC-3 is involved in the human repair disorders xeroderma pigmentosum and Cockayne's syndrome.
|
Weeda G, van Ham RC, Vermeulen W, Bootsma D, van der Eb AJ, Hoeijmakers JH
|
Cell
Aug. 24, 1990
|
|
Structure and expression of the human XPBC/ERCC-3 gene involved in DNA repair disorders xeroderma pigmentosum and Cockayne's syndrome.
|
Weeda G, Ma LB, van Ham RC, van der Eb AJ, Hoeijmakers JH
|
Nucleic Acids Res
Nov. 25, 1991
|
|
Clinical heterogeneity within xeroderma pigmentosum associated with mutations in the DNA repair and transcription gene ERCC3.
|
Vermeulen W, Scott RJ, Rodgers S, Muller HJ, Cole J, Arlett CF, Kleijer WJ, Bootsma D, Hoeijmakers JH, Weeda G
|
Am J Hum Genet
Jan. 1, 1994
|
|
Correction of xeroderma pigmentosum repair defect by basal transcription factor BTF2 (TFIIH).
|
van Vuuren AJ, Vermeulen W, Ma L, Weeda G, Appeldoorn E, Jaspers NG, van der Eb AJ, Bootsma D, Hoeijmakers JH, Humbert S, et al.
|
EMBO J
April 1, 1994
|
|
The 62- and 80-kDa subunits of transcription factor IIH mediate the interaction with Epstein-Barr virus nuclear protein 2.
|
Tong X, Drapkin R, Reinberg D, Kieff E
|
Proc Natl Acad Sci U S A
April 11, 1995
|
|
A mutation in the XPB/ERCC3 DNA repair transcription gene, associated with trichothiodystrophy.
|
Weeda G, Eveno E, Donker I, Vermeulen W, Chevallier-Lagente O, Taieb A, Stary A, Hoeijmakers JH, Mezzina M, Sarasin A
|
Am J Hum Genet
Jan. 1, 1997
|
|
Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
|
Kershnar E, Wu SY, Chiang CM
|
J Biol Chem
Dec. 18, 1998
|
|
A summary of mutations in the UV-sensitive disorders: xeroderma pigmentosum, Cockayne syndrome, and trichothiodystrophy.
|
Cleaver JE, Thompson LH, Richardson AS, States JC
|
Hum Mutat
Jan. 1, 1999
|
|
Reconstitution of the transcription factor TFIIH: assignment of functions for the three enzymatic subunits, XPB, XPD, and cdk7.
|
Tirode F, Busso D, Coin F, Egly JM
|
Mol Cell
Feb. 1, 1999
|
|
The FBP interacting repressor targets TFIIH to inhibit activated transcription.
|
Liu J, He L, Collins I, Ge H, Libutti D, Li J, Egly JM, Levens D
|
Mol Cell
Jan. 1, 2000
|
|
Identification of four single nucleotide polymorphisms in DNA repair genes: XPA and XPB (ERCC3) in Polish population.
|
Butkiewicz D, Rusin M, Harris CC, Chorazy M
|
Hum Mutat
June 1, 2000
|
|
Defective interplay of activators and repressors with TFIH in xeroderma pigmentosum.
|
Liu J, Akoulitchev S, Weber A, Ge H, Chuikov S, Libutti D, Wang XW, Conaway JW, Harris CC, Conaway RC, Reinberg D, Levens D
|
Cell
Jan. 9, 2001
|
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
|
Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
|
Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK
|
Nature
April 7, 2005
|
|
The consensus coding sequences of human breast and colorectal cancers.
|
Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE
|
Science
Oct. 13, 2006
|
|
Phenotypic heterogeneity in the XPB DNA helicase gene (ERCC3): xeroderma pigmentosum without and with Cockayne syndrome.
|
Oh KS, Khan SG, Jaspers NG, Raams A, Ueda T, Lehmann A, Friedmann PS, Emmert S, Gratchev A, Lachlan K, Lucassan A, Baker CC, Kraemer KH
|
Hum Mutat
Nov. 1, 2006
|
|
Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
|
Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M
|
Cell
Nov. 3, 2006
|
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|