Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
TREX2 |
Protein FULL name:
three prime repair exonuclease 2 isoform a; expressed-Xq28STS protein; 26S proteasome-associated UCH interacting protein 1; 3'-5' exonuclease; Xq28, 2000bp sequence contg. ORF [Homo sapiens].
TREX2 (Homo sapiens) is product of expression of TREX2 gene.
FUNCTION: Exonuclease with a preference for double stranded DNA with mismatched 3' termini. May play a role in DNA repair.
CATALYTIC ACTIVITY: Exonucleolytic cleavage in the 3'- to 5'- direction to yield nucleoside 5'-phosphates.
COFACTOR: Magnesium. Required for activity. Substitution with Mn(2+) results in partial activity.
BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.5-8.0;
SUBUNIT: Homodimer.
SUBCELLULAR LOCATION: Nucleus (Probable).
TISSUE SPECIFICITY: Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
SIMILARITY: Belongs to the exonuclease superfamily. TREX family.
CAUTION: The gene for this protein is either identical to or adjacent to that of UCHL5IP. Most mRNAs that encode UCHL5IP also include the N-terminal part of TREX2.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
6005918 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9BQ50 |
Q9BQ50 |
| PFAM: | - |
Q9BQ50 (Link - using uniprot id) |
| InterPro: | - |
Q9BQ50 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGA LVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRT LQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPA LRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLI FLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA |
TREX2 (Homo sapiens) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Identification and expression of the TREX1 and TREX2 cDNA sequences encoding mammalian 3'-->5' exonucleases. | Mazur DJ, Perrino FW | J Biol Chem July 9, 1999 |
| Structure and expression of the TREX1 and TREX2 3' --> 5' exonuclease genes. | Mazur DJ, Perrino FW | J Biol Chem May 4, 2001 |
| Excision of 3' termini by the Trex1 and TREX2 3'-->5' exonucleases. Characterization of the recombinant proteins. | Mazur DJ, Perrino FW | J Biol Chem May 18, 2001 |
| The human TREX2 3' -> 5'-exonuclease structure suggests a mechanism for efficient nonprocessive DNA catalysis. | Perrino FW, Harvey S, McMillin S, Hollis T | J Biol Chem April 15, 2005 |
Last modification of this entry: Oct. 11, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|