Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
XRCC3 |
Protein FULL name:
DNA repair protein XRCC3, X-ray repair cross-complementing protein 3
XRCC3 (Homo sapiens) is product of expression of XRCC3 gene.
FUNCTION: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions.
SUBUNIT: Interacts with RAD51C and RAD51. Part of a complex consisting of RAD51B, RAD51C, RAD51D, XRCC2 and XRCC3.
SUBCELLULAR LOCATION: Nucleus (Probable).
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR.
SIMILARITY: Belongs to the recA family. RAD51 subfamily.
WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; [LINK]
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
4885659 153946427 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | O43542 |
O43542 |
| PFAM: | - |
O43542 (Link - using uniprot id) |
| InterPro: | - |
O43542 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLL RTASLHLRGSSILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLD GITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYICTEDAFPHKR LQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPV LLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQ SPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH |
XRCC3 (Homo sapiens) is able to recognize following damages:
References:
| Title | Authors | Journal |
| XRCC2 and XRCC3, new human Rad51-family members, promote chromosome stability and protect against DNA cross-links and other damages. | Liu N, Lamerdin JE, Tebbs RS, Schild D, Tucker JD, Shen MR, Brookman KW, Siciliano MJ, Walter CA, Fan W, Narayana LS, Zhou ZQ, Adamson AW, Sorensen KJ, Chen DJ, Jones NJ, Thompson LH | Mol Cell May 1, 1998 |
| A variant within the DNA repair gene XRCC3 is associated with the development of melanoma skin cancer. | Winsey SL, Haldar NA, Marsh HP, Bunce M, Marshall SE, Harris AL, Wojnarowska F, Welsh KI | Cancer Res Oct. 15, 2000 |
| Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells. | Liu N, Schild D, Thelen MP, Thompson LH | Nucleic Acids Res Jan. 15, 2002 |
| RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51. | Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS | J Biol Chem March 8, 2002 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. | Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ | Science May 25, 2007 |
Last modification of this entry: Oct. 11, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|