Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mre11p |
Mre11p is involved in:
NHEJ in Saccharomyces cerevisiae
- MRX complex joins the DNA/YKu70/80 complex in Saccharomyces cerevisiae
- Gap filling and non-ligatable DNA ends processing in Saccharomyces cerevisiae
Keywords:
- double-strand break (DSB)
- non-homologues end-joining (NHEJ)
- homologous recombination repair (HRR)
- cell cycle checkpoint control
- response to DNA damage
FUNCTION: Involved in DNA double-strand break repair (DSBR). Possesses single-strand endonuclease activity and double-strand- specific 3'-5' exonuclease activity. Also involved in meiotic DSB processing.
COFACTOR: Manganese (By similarity).
SUBUNIT: Forms a complex with RAD50 and XRS2.
INTERACTION: Q06032:CST9; NbExp=1; IntAct=EBI-11255, EBI-30044;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 432 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the MRE11/RAD32 family.
| NCBI GenPept GI number(s): |
1513065 6323880 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P32829 |
P32829 |
| PFAM: | - |
P32829 (Link - using uniprot id) |
| InterPro: | - |
P32829 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDYPDPDTIRILITTDNHVGYNENDPITGDDSWKTFHEVMMLAKNNNVDM VVQSGDLFHVNKPSKKSLYQVLKTLRLCCMGDKPCELELLSDPSQVFHYD EFTNVNYEDPNFNISIPVFGISGNHDDASGDSLLCPMDILHATGLINHFG KVIESDKIKVVPLLFQKGSTKLALYGLAAVRDERLFRTFKDGGVTFEVPT MREGEWFNLMCVHQNHTGHTNTAFLPEQFLPDFLDMVIWGHEHECIPNLV HNPIKNFDVLQPGSSVATSLCEAEAQPKYVFILDIKYGEAPKMTPIPLET IRTFKMKSISLQDVPHLRPHDKDATSKYLIEQVEEMIRDANEETKQKLAD DGEGDMVAELPKPLIRLRVDYSAPSNTQSPIDYQVENPRRFSNRFVGRVA NGNNVVQFYKKRSPVTRSKKSGINGTSISDRDVEKLFSESGGELEVQTLV NDLLNKMQLSLLPEVGLNEAVKKFVDKDEKTALKEFISHEISNEVGILST NEEFLRTDDAEEMKALIKQVKRANSVRPTPPKENDETNFAFNGNGLDSFR SSNREVRTGSPDITQSHVDNESRITHISQAESSKPTSKPKRVRTATKKKI PAFSDSTVISDAENELGDNNDAQDDVDIDENDIIMVSTDEEDASYGLLNG RKTKTKTRPAASTKTASRRGKGRASRTPKTDILGSLLAKKRK |
Mre11p (Saccharomyces cerevisiae) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Functions of the yeast meiotic recombination genes, MRE11 and MRE2. | Ogawa H, Johzuka K, Nakagawa T, Leem SH, Hagihara AH | Adv Biophys Jan. 1, 1995 |
| Interaction of Mre11 and Rad50: two proteins required for DNA repair and meiosis-specific double-strand break formation in Saccharomyces cerevisiae. | Johzuka K, Ogawa H | Genetics April 1, 1995 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. | Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B | Nature May 1, 1997 |
| The 3' to 5' exonuclease activity of Mre 11 facilitates repair of DNA double-strand breaks. | Paull TT, Gellert M | Mol Cell June 1, 1998 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 16, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|