Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
UvrD |
Protein FULL name:
DNA helicase II [Escherichia coli str. K-12 substr. MG1655].
UvrD (Escherichia coli strain K-12 substr. MG1655) is product of expression of uvrD gene.
UvrD is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
- UvrD joins the protein-DNA complex in Escherichia coli strain K-12 substr. MG1655
- oligomer and UvrC leaves DNA in ATP-dependent reaction in Escherichia coli strain K-12 substr. MG1655
Keywords:
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- response to DNA damage
- global genome repair NER (GGR-NER)
FUNCTION: Has both ATPase and helicase activities. Unwinds DNA duplexes with 3' to 5' polarity with respect to the bound strand and initiates unwinding most effectively when a single-stranded region is present. Involved in the post-incision events of nucleotide excision repair and methyl-directed mismatch repair.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
INTERACTION: P0A9P0:lpdA; NbExp=1; IntAct=EBI-559573, EBI-542856; P25665:metE; NbExp=1; IntAct=EBI-559573, EBI-551247; P23367:mutL; NbExp=4; IntAct=EBI-559573, EBI-554913;
SIMILARITY: Belongs to the helicase family. UvrD subfamily.
SIMILARITY: Contains 1 uvrD-like helicase ATP-binding domain.
SIMILARITY: Contains 1 uvrD-like helicase C-terminal domain.
| NCBI GenPept GI number(s): |
148212 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P03018 |
P03018 |
| PFAM: | - |
P03018 (Link - using uniprot id) |
| InterPro: | - |
P03018 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MDVSYLLDSLNDKQREAVAAPRSNLLVLAGAGSGKTRVLVHRIAWLMSVE NCSPYSIMAVTFTNKAAAEMRHRIGQLMGTSQGGMWVGTFHXLAHRLLXA HHMDANLPQDFQILDSEDQLRLLKRLIKAMNLDEKQWPPRQAMWYINSQK DEGLRPHHIQSYGNPVEQTWQKVYQAYQEACDRAGLVDFAELLLRAHELW LNKPHILQHYRERFTNILVDEFQDTNNIQYAWIRLLAGDTGKVMIVGDDD QSIYGWRGAQVENIQRFLNDFPGAETIRLEQNYRSTSNILSAANALIENN NGRLGKKLWTDGADGEPISLYCAFNELDEARFVVNRIKTWQDNGGALAEC AILYRSNAQSRVLEEALLQASMPYRIYGGMRFFERQEIKDALSYLRLIAN RNDDAAFERVVNTPTRGIGDRTLDVVRQTSRDRQLTLWQACRELLQEKAL AGRAASALQRFMELIDALAQETADMPLHVQTDRVIKDSGLRTMYEQEKGE KGQTRIENLEELVTATRQFSYNEEDEDLMPLQAFLSHAALEAGEGQADTW QDAVQLMTLHSAKGLEFPQVFIVGMEEGMFPSQMSLDEGGRLEEERRLAY VGVTRAMQKLTLTYAETRRLYGKEVYHRPSRFIGELPEECVEEVRLRATV SRPVSHQRMGTPMVENDSGYKLGQRVRHAKFGEGTIVNMEGSGEHSRLQV AFQGQGIKWLVAAYARLESV |
References:
| Title | Authors | Journal |
| Transcription of the uvrD gene of Escherichia coli is controlled by the lexA repressor and by attenuation. | Easton AM, Kushner SR | Nucleic Acids Res Dec. 20, 1983 |
| The nucleotide sequence of the uvrD gene of E. coli. | Finch PW, Emmerson PT | Nucleic Acids Res July 25, 1984 |
| Determination of the initiation sites of transcription and translation of the uvrD gene of Escherichia coli. | Yamamoto Y, Ogawa T, Shinagawa H, Nakayama T, Matsuo H, Ogawa H | J Biochem June 1, 1986 |
| Recombination at ColE1 cer requires the Escherichia coli xerC gene product, a member of the lambda integrase family of site-specific recombinases. | Colloms SD, Sykora P, Szatmari G, Sherratt DJ | J Bacteriol Dec. 1, 1990 |
| Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes. | Daniels DL, Plunkett G 3rd, Burland V, Blattner FR | Science Aug. 7, 1992 |
| Characterization of DNA helicase II from a uvrD252 mutant of Escherichia coli. | Washburn BK, Kushner SR | J Bacteriol Feb. 1, 1993 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|