Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Msh2 |
Protein FULL name:
DNA mismatch repair protein Msh2 [Mus musculus].
Msh2 (Mus musculus) is product of expression of Msh2 gene.
FUNCTION: Component of the post-replicative DNA mismatch repair system (MMR). Forms two different heterodimers: MutS alpha (MSH2- MSH6 heterodimer) and MutS beta (MSH2-MSH3 heterodimer) which binds to DNA mismatches thereby initiating DNA repair. When bound, heterodimers bend the DNA helix and shields approximately 20 base pairs. MutS alpha recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. MutS beta recognizes larger insertion-deletion loops up to 13 nucleotides long. After mismatch binding, MutS alpha or beta forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch: mismatched DNA provokes ADP-->ATP exchange, resulting in a discernible conformational transition that converts MutS alpha into a sliding clamp capable of hydrolysis-independent diffusion along the DNA backbone. This transition is crucial for mismatch repair. MutS alpha may also play a role in DNA homologous recombination repair. In melanocytes may modulate both UV-B-induced cell cycle regulation and apoptosis (By similarity).
SUBUNIT: Heterodimer consisting of MSH2-MSH6 (MutS alpha) or MSH2- MSH3 (MutS beta). Both heterodimer form a ternary complex with MutL alpha (MLH1-PMS1). Interacts with EXO1. Part of the BRCA1- associated genome surveillance complex (BASC), which contains BRCA1, MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the RAD50-MRE11-NBS1 protein complex. This association could be a dynamic process changing throughout the cell cycle and within subnuclear domains. Interacts with ATR. Interacts with BTBD12/SLX4; this interaction is direct and links MutS beta to SLX4, a subunit of different structure-specific endonucleases (By similarity).
SUBCELLULAR LOCATION: Nucleus (Probable).
PTM: Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity).
SIMILARITY: Belongs to the DNA mismatch repair mutS family.
| NCBI GenPept GI number(s): |
6678938 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | P43247 |
P43247 |
| PFAM: | - |
P43247 (Link - using uniprot id) |
| InterPro: | - |
P43247 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MAVQPKETLQLEGAAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDA LLAAREVFKTQGVIKYMGPAGSKTLQSVVLSKMNFESFVKDLLLVRQYRV EVYKNKAGNKASKENEWYLAFKASPGNLSQFEDILFGNNDMSASVGVMGI KMAVVDGQRHVGVGYVDSTQRKLGLCEFPENDQFSNLEALLIQIGPKECV LPGGETTGDMGKLRQVIQRGGILITERKRADFSTKDIYQDLNRLLKGKKG EQINSAALPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELATFDFSQYM KLDMAAVRALNLFQGSVEDTTGSQSLAALLNKCKTAQGQRLVNQWIKQPL MDRNRIEERLNLVEAFVEDSELRQSLQEDLLRRFPDLNRLAKKFQRQAAN LQDCYRLYQGINQLPSVIQALEKYEGRHQALLLAVFVTPLIDLRSDFSKF QEMIETTLDMDQVENHEFLVKPSFDPNLSELREVMDGLEKKMQSTLINAA RGLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVK FTNSELSSLNEEYTKNKGEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLA HLDAIVSFAHVSNAAPVPYVRPVILEKGKGRIILKASRHACVEVQDEVAF IPNDVHFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESA EVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDEL GRGTSTYDGFGLAWAISDYIATKIGAFCMFATHFHELTALANQIPTVNNL HVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHVIACAKQKALE LEEFQNIGTSLGCDEAEPAAKRRCLEREQGEKIILEFLSKVKQVPFTAMS EESISAKLKQLKAEVVAKNNSFVNEIISRIKAPAP |
Msh2 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Cloning and expression of the Xenopus and mouse Msh2 DNA mismatch repair genes. | Varlet I, Pallard C, Radman M, Moreau J, de Wind N | Nucleic Acids Res Dec. 25, 1994 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|