Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Dclre1a |
Protein FULL name:
DNA cross-link repair 1A protein [Mus musculus].
Dclre1a (Mus musculus) is product of expression of Dclre1a gene.
FUNCTION: May be required for DNA interstrand cross-link repair. Also required for checkpoint mediated cell cycle arrest in early prophase in response to mitotic spindle poisons.
SUBUNIT: Binds constitutively to TP53BP1. Binds CDC27, which is itself a component of the anaphase promoting complex (APC). Binds PIAS1 (By similarity).
SUBCELLULAR LOCATION: Nucleus (By similarity). Note=In some cells it may be found in typically 1 or 2 discrete nuclear aggregates of unknown function which also contain TP53BP1. Also found in multiple discrete nuclear foci which increase in number following treatment with ionizing radiation or interstrand cross-linking agents. These foci overlap with those formed by the MRN complex (composed of MRE11A, RAD50 and NBN) and BRCA1 (By similarity).
SIMILARITY: Belongs to the DNA repair metallo-beta-lactamase (DRMBL) family.
SEQUENCE CAUTION: Sequence=AAH72667.1; Type=Miscellaneous discrepancy; Note=Intron retention;
| NCBI GenPept GI number(s): |
114145469 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9JIC3 |
Q9JIC3 |
| PFAM: | - |
Q9JIC3 (Link - using uniprot id) |
| InterPro: | - |
Q9JIC3 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MLEDTFWEEEIWEYKSKRKPKPVHPNNCSENISESVEKSTDGKHQSKGNE KRTSENPGKTKDHKVCLAETDSQISAGSSQSSSCRDESQQSQNKETTPKK QHRTRRGKQVTPKVRPVYDGYCPSCQMPFSSLLGQTPQWHVFECLDSPPI SDTECPEGLLCTSTIPSHYKKYTHILLAQSRDSKEPLGSPSDALAGLFAA AAPGSPCNLEERRSMTLKTENLRKVSDHSLLMMQYLETSQPSAEINRKNV SSPCSQTSPVPQCAEFVKRDQLVGGGSPLAEVALNSQSKSGSMGLPLPEN DTDSCEISYSPLHSDEETYDIDQELDDSQQELFFTQSSKDSSLEEDGSAI FENLHGPSPKEAEGIRPTAKSLVAQARCSAPSEGSTLSDSFLLLFYTSNR LSQEDLPHTDAAFHLLSPALAVGGAASNYQTSKAKLDEPEKFLSLASSHQ QQKIETSAVGNQTSLPLLTRARSKPLEKEGGKCLPLHPTQSQTRGSPRKG LGAPGANCACRNAQKRSSMPLDKPLGTSPSSPKCSPSQPSKKVMKQMDIG VFFGLPPKRQETSLRESASEGPNVSPVVSPNQKRPRLCKRKAQSSLSDLE FDAKNLNESQHSVGLSGEKRQHRRKRHKTSNSPREGPCQRRSGHLMNNPE LGPVILSKGKAFVRRTRGRTQRGNMNISESSGAGEVRRTCPFYKRIPGTG FTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKDFTRPVYCSEITGNLLKK KLRVQEQYIRQLPMDTECVVDSVKVVLLDANHCPGATMILFQLPNGAVIL HTGDFRADPSMERSRLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINT AFEAVTLNPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCL NIPEVSSLITTDMCDSLVHLLPMMQINFKGLQSHLKKCGGKYDQILAFRP TGWTHSNNITSTADIIPQTRGNISIYGIPYSEHSSYLEMKRFVQWLKPQK IIPTVNVGSFRSRNTMEKYFKEWRLEAGY |
Dclre1a (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| Disruption of mouse SNM1 causes increased sensitivity to the DNA interstrand cross-linking agent mitomycin C. | Dronkert ML, de Wit J, Boeve M, Vasconcelos ML, van Steeg H, Tan TL, Hoeijmakers JH, Kanaar R | Mol Cell Biol July 1, 2000 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Deficiency in SNM1 abolishes an early mitotic checkpoint induced by spindle stress. | Akhter S, Richie CT, Deng JM, Brey E, Zhang X, Patrick C Jr, Behringer RR, Legerski RJ | Mol Cell Biol Dec. 1, 2004 |
| Large-scale phosphorylation analysis of mouse liver. | Villen J, Beausoleil SA, Gerber SA, Gygi SP | Proc Natl Acad Sci U S A Feb. 1, 2007 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|